eF-site ID 2wng-A
PDB Code 2wng
Chain A

click to enlarge
Title complete extracellular structure of human signal regulatory protein (SIRP) alpha
Classification CELL ADHESION
Compound TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE SUBSTRATE 1
Source (2WNG)
Sequence A:  EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFR
GAGPARELIYNQKEGHFPRVTTVSKRENMDFSISISNITP
ADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPSAPVVS
GPAARATPQHTVSFTCESHGFSPRDITLKWFKNGNELSDF
QTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVAHVT
LQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQ
VRKFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMS
WLLVDVKLTCQVEHDGQPAVSKSHDLK
Description (1)  TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE SUBSTRATE 1


Functional site

1) chain A
residue 80
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG A 1239
source : AC1

2) chain A
residue 82
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAG A 1239
source : AC1

3) chain A
residue 230
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE NAG A 1239
source : AC1

4) chain A
residue 239
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAG A 1239
source : AC1

5) chain A
residue 241
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAG A 1239
source : AC1

6) chain A
residue 282
type
ligand
sequence M
description BINDING SITE FOR RESIDUE NAG A 1239
source : AC1

7) chain A
residue 284
type
ligand
sequence W
description BINDING SITE FOR RESIDUE NAG A 1239
source : AC1

8) chain A
residue 230
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence Q
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2wng_A_1239

9) chain A
residue 239
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2wng_A_1239

10) chain A
residue 241
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence T
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2wng_A_1239

11) chain A
residue 282
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence M
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2wng_A_1239

12) chain A
residue 284
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence W
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2wng_A_1239

13) chain A
residue 286
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence L
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_2wng_A_1239


Display surface

Download
Links