eF-site ID 2wng-A
PDB Code 2wng
Chain A

click to enlarge
Title complete extracellular structure of human signal regulatory protein (SIRP) alpha
Classification CELL ADHESION
Compound TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE SUBSTRATE 1
Source (2WNG)
Sequence A:  EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFR
GAGPARELIYNQKEGHFPRVTTVSKRENMDFSISISNITP
ADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPSAPVVS
GPAARATPQHTVSFTCESHGFSPRDITLKWFKNGNELSDF
QTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVAHVT
LQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQ
VRKFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMS
WLLVDVKLTCQVEHDGQPAVSKSHDLK
Description (1)  TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE SUBSTRATE 1

Display surface

Download
Links