eF-site ID 2v7a-A PDB Code 2v7a Chain A click to enlarge Title Crystal structure of the T315I Abl mutant in complex with the inhibitor PHA-739358 Classification TRANSFERASE Compound PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1 Source (ABL1_HUMAN) Sequence A:  DKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKT LKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFY IIIEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAME YLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDT XTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEI ATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELM RACWQWNPSDRPSFAEIHQAFETMFQESSIS Description Functional site 1) chain A residue 248 type sequence L description BINDING SITE FOR RESIDUE 627 A 1504 source : AC1 2) chain A residue 250 type sequence G description BINDING SITE FOR RESIDUE 627 A 1504 source : AC1 3) chain A residue 269 type sequence A description BINDING SITE FOR RESIDUE 627 A 1504 source : AC1 4) chain A residue 271 type sequence K description BINDING SITE FOR RESIDUE 627 A 1504 source : AC1 5) chain A residue 316 type sequence E description BINDING SITE FOR RESIDUE 627 A 1504 source : AC1 6) chain A residue 317 type sequence F description BINDING SITE FOR RESIDUE 627 A 1504 source : AC1 7) chain A residue 318 type sequence M description BINDING SITE FOR RESIDUE 627 A 1504 source : AC1 8) chain A residue 319 type sequence T description BINDING SITE FOR RESIDUE 627 A 1504 source : AC1 9) chain A residue 321 type sequence G description BINDING SITE FOR RESIDUE 627 A 1504 source : AC1 10) chain A residue 367 type sequence R description BINDING SITE FOR RESIDUE 627 A 1504 source : AC1 11) chain A residue 370 type sequence L description BINDING SITE FOR RESIDUE 627 A 1504 source : AC1 12) chain A residue 368 type sequence N description BINDING SITE FOR RESIDUE MG A 1505 source : AC3 13) chain A residue 381 type sequence D description BINDING SITE FOR RESIDUE MG A 1505 source : AC3 14) chain A residue 248-271 type prosite sequence LGGGQYGEVYEGVWKKYSLTVAVK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. LGGGQYGEVYeGvwkkyslt..........VAVK source prosite : PS00107 15) chain A residue 359-371 type prosite sequence FIHRDLAARNCLV description PROTEIN_KINASE_TYR Tyrosine protein kinases specific active-site signature. FIHrDLAARNCLV source prosite : PS00109 16) chain A residue 363 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10028 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 248 type BINDING sequence L description source Swiss-Prot : SWS_FT_FI2 18) chain A residue 271 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 19) chain A residue 316 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI2 20) chain A residue 253 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI4 21) chain A residue 257 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI4 22) chain A residue 413 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI4 23) chain A residue 393 type MOD_RES sequence X description Phosphotyrosine; by autocatalysis and SRC-type Tyr-kinases => ECO:0000269|PubMed:16912036 source Swiss-Prot : SWS_FT_FI5 24) chain A residue 446 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P00520 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links