eF-site ID 2qrz-A PDB Code 2qrz Chain A click to enlarge Title Cdc42 bound to GMP-PCP: Induced Fit by Effector is Required Classification CELL CYCLE Compound Cell division control protein 42 homolog precursor Source Homo sapiens (Human) (CDC42_HUMAN) Sequence A:  MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNY AVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLV CFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSAL TQKGLKNVFDEAILAALEPPEPKKSRRCV Description (1)  Cell division control protein 42 homolog precursor Functional site 1) chain A residue 17 type sequence T description BINDING SITE FOR RESIDUE MG A 190 source : AC1 2) chain A residue 164 type sequence G description BINDING SITE FOR RESIDUE SO4 A 3638 source : AC3 3) chain A residue 13 type sequence A description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 4) chain A residue 15 type sequence G description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 5) chain A residue 16 type sequence K description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 6) chain A residue 17 type sequence T description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 7) chain A residue 18 type sequence C description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 8) chain A residue 60 type sequence G description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 9) chain A residue 61 type sequence Q description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 10) chain A residue 116 type sequence Q description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 11) chain A residue 118 type sequence D description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 12) chain A residue 119 type sequence L description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 13) chain A residue 158 type sequence S description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 14) chain A residue 159 type sequence A description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 15) chain A residue 160 type sequence L description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 16) chain A residue 10 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 17) chain A residue 115 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI1 18) chain A residue 57 type BINDING sequence D description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 19) chain A residue 32 type MOD_RES sequence Y description (Microbial infection) O-AMP-tyrosine; by Haemophilus IbpA; alternate => ECO:0000269|PubMed:19362538, ECO:0000269|PubMed:20622875 source Swiss-Prot : SWS_FT_FI3 20) chain A residue 35 type MOD_RES sequence T description (Microbial infection) O-AMP-threonine; by Vibrio VopS => ECO:0000269|PubMed:19039103 source Swiss-Prot : SWS_FT_FI4 21) chain A residue 64 type MOD_RES sequence Y description Phosphotyrosine; by SRC => ECO:0000269|PubMed:14506284 source Swiss-Prot : SWS_FT_FI5 22) chain A residue 188 type MOD_RES sequence C description Cysteine methyl ester => ECO:0000269|PubMed:10676816, ECO:0007744|PDB:1DOA source Swiss-Prot : SWS_FT_FI6 23) chain A residue 188 type LIPID sequence C description S-geranylgeranyl cysteine => ECO:0000269|PubMed:10676816, ECO:0007744|PDB:1DOA source Swiss-Prot : SWS_FT_FI7 24) chain A residue 32 type CARBOHYD sequence Y description (Microbial infection) O-linked (GlcNAc) tyrosine; by Photorhabdus PAU_02230; alternate => ECO:0000269|PubMed:24141704 source Swiss-Prot : SWS_FT_FI8 25) chain A residue 35 type CARBOHYD sequence T description (Microbial infection) O-linked (Glc) threonine; by C.difficile toxins TcdA and TcdB; alternate => ECO:0000269|PubMed:24905543, ECO:0000269|PubMed:7775453, ECO:0000269|PubMed:7777059 source Swiss-Prot : SWS_FT_FI9

Display surface Download Links