eF-site ID 2qc8-H
PDB Code 2qc8
Chain H

click to enlarge
Title Crystal structure of human glutamine synthetase in complex with ADP and methionine sulfoximine phosphate
Classification LIGASE
Compound Glutamine synthetase
Source Homo sapiens (Human) (GLNA_HUMAN)
Sequence H:  NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDS
EPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPF
RKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHP
WFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADR
AYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPC
EGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNG
AGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYD
PKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTV
GQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
Description (1)  Glutamine synthetase (E.C.6.3.1.2)


Functional site

1) chain H
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN H 401
source : CC4

2) chain H
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN H 401
source : CC4

3) chain H
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN H 401
source : CC4

4) chain H
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN H 402
source : CC5

5) chain H
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN H 402
source : CC5

6) chain H
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN H 402
source : CC5

7) chain H
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN H 403
source : CC6

8) chain H
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN H 403
source : CC6

9) chain H
residue 193
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL G 708
source : EC2

10) chain H
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL I 709
source : EC3

11) chain H
residue 132
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

12) chain H
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

13) chain H
residue 191
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

14) chain H
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

15) chain H
residue 205
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

16) chain H
residue 207
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

17) chain H
residue 208
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

18) chain H
residue 255
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

19) chain H
residue 257
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

20) chain H
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

21) chain H
residue 324
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

22) chain H
residue 336
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

23) chain H
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

24) chain H
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

25) chain H
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

26) chain H
residue 162
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

27) chain H
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

28) chain H
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

29) chain H
residue 249
type
ligand
sequence G
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

30) chain H
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

31) chain H
residue 299
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

32) chain H
residue 305
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

33) chain H
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

34) chain H
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

35) chain H
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

36) chain H
residue 63
type
ligand
sequence D
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

37) chain H
residue 62-79
type prosite
ligand
sequence FDGSSTLQSEGSNSDMYL
description Glutamine synthetase signature 1. [FYWL]-D-G-S-S-x(6,8)-[DENQSTAK]-[SA]-[DE]-x(2)-[LIVMFY]
source prosite : PS00180

38) chain H
residue 241-257
type prosite
ligand
sequence KPIPGNWNGAGCHTNFS
description Glutamine synthetase putative ATP-binding region signature. K-P-[LIVMFYA]-x(3,5)-[NPAT]-[GA]-[GSTAN]-[GA]-x-H-x(3)-S
source prosite : PS00181

39) chain H
residue 130-134
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WFGME
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

40) chain H
residue 191
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence A
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

41) chain H
residue 194
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence N
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

42) chain H
residue 203
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

43) chain H
residue 205-208
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence QIGP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

44) chain H
residue 253
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence H
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

45) chain H
residue 255-257
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NFS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

46) chain H
residue 262
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

47) chain H
residue 319
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

48) chain H
residue 324
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

49) chain H
residue 335-336
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence GY
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

50) chain H
residue 338
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

51) chain H
residue 340
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

52) chain H
residue 134
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

53) chain H
residue 136
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

54) chain H
residue 162
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Y
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

55) chain H
residue 194
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence N
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

56) chain H
residue 196-197
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence EV
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

57) chain H
residue 201
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Q
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

58) chain H
residue 203
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

59) chain H
residue 248-251
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence NGAG
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

60) chain H
residue 253
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence H
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

61) chain H
residue 299
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

62) chain H
residue 304-306
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence HET
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

63) chain H
residue 319
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

64) chain H
residue 324
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

65) chain H
residue 338
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

66) chain H
residue 340
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

67) chain H
residue 43
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence K
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

68) chain H
residue 60-61
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WN
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

69) chain H
residue 63
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence D
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

70) chain H
residue 66
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence S
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

71) chain H
residue 319
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1hto
source CSA : CSA8

72) chain H
residue 305
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1hto
source CSA : CSA8

73) chain H
residue 63
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1hto
source CSA : CSA8


Display surface

Download
Links