eF-site ID 2qc8-G
PDB Code 2qc8
Chain G

click to enlarge
Title Crystal structure of human glutamine synthetase in complex with ADP and methionine sulfoximine phosphate
Classification LIGASE
Compound Glutamine synthetase
Source Homo sapiens (Human) (GLNA_HUMAN)
Sequence G:  NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDS
EPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPF
RKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHP
WFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADR
AYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPC
EGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNG
AGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYD
PKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTV
GQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
Description (1)  Glutamine synthetase (E.C.6.3.1.2)


Functional site

1) chain G
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN G 401
source : CC1

2) chain G
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN G 401
source : CC1

3) chain G
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN G 401
source : CC1

4) chain G
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN G 402
source : CC2

5) chain G
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN G 402
source : CC2

6) chain G
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN G 402
source : CC2

7) chain G
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN G 403
source : CC3

8) chain G
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN G 403
source : CC3

9) chain G
residue 193
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL G 707
source : EC1

10) chain G
residue 29
type
ligand
sequence M
description BINDING SITE FOR RESIDUE CL G 708
source : EC2

11) chain G
residue 43
type
ligand
sequence K
description BINDING SITE FOR RESIDUE CL G 708
source : EC2

12) chain G
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL G 708
source : EC2

13) chain G
residue 130
type
ligand
sequence W
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

14) chain G
residue 132
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

15) chain G
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

16) chain G
residue 191
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

17) chain G
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

18) chain G
residue 205
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

19) chain G
residue 206
type
ligand
sequence I
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

20) chain G
residue 207
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

21) chain G
residue 208
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

22) chain G
residue 255
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

23) chain G
residue 257
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

24) chain G
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

25) chain G
residue 324
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

26) chain G
residue 336
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

27) chain G
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

28) chain G
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

29) chain G
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

30) chain G
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

31) chain G
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

32) chain G
residue 248
type
ligand
sequence N
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

33) chain G
residue 249
type
ligand
sequence G
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

34) chain G
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

35) chain G
residue 299
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

36) chain G
residue 305
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

37) chain G
residue 306
type
ligand
sequence T
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

38) chain G
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

39) chain G
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

40) chain G
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

41) chain G
residue 63
type
ligand
sequence D
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

42) chain G
residue 62-79
type prosite
ligand
sequence FDGSSTLQSEGSNSDMYL
description Glutamine synthetase signature 1. [FYWL]-D-G-S-S-x(6,8)-[DENQSTAK]-[SA]-[DE]-x(2)-[LIVMFY]
source prosite : PS00180

43) chain G
residue 241-257
type prosite
ligand
sequence KPIPGNWNGAGCHTNFS
description Glutamine synthetase putative ATP-binding region signature. K-P-[LIVMFYA]-x(3,5)-[NPAT]-[GA]-[GSTAN]-[GA]-x-H-x(3)-S
source prosite : PS00181

44) chain G
residue 130-134
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WFGME
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

45) chain G
residue 191
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence A
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

46) chain G
residue 203
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

47) chain G
residue 205-208
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence QIGP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

48) chain G
residue 253
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence H
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

49) chain G
residue 255-257
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NFS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

50) chain G
residue 262
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

51) chain G
residue 319
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

52) chain G
residue 324
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

53) chain G
residue 335-336
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence GY
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

54) chain G
residue 338
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

55) chain G
residue 134
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

56) chain G
residue 136
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

57) chain G
residue 162
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Y
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

58) chain G
residue 194
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence N
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

59) chain G
residue 196-197
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence EV
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

60) chain G
residue 201
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Q
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

61) chain G
residue 203
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

62) chain G
residue 248-251
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence NGAG
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

63) chain G
residue 253
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence H
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

64) chain G
residue 299
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

65) chain G
residue 304-306
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence HET
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

66) chain G
residue 319
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

67) chain G
residue 324
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

68) chain G
residue 338
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

69) chain G
residue 340
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

70) chain G
residue 43
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence K
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

71) chain G
residue 60-61
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WN
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

72) chain G
residue 63
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence D
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

73) chain G
residue 66
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence S
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

74) chain G
residue 319
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1hto
source CSA : CSA7

75) chain G
residue 305
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1hto
source CSA : CSA7

76) chain G
residue 63
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1hto
source CSA : CSA7


Display surface

Download
Links