eF-site ID 2in6-A PDB Code 2in6 Chain A click to enlarge Title Wee1 kinase complex with inhibitor PD311839 Classification TRANSFERASE Compound Wee1-like protein kinase Source Homo sapiens (Human) (WEE1_HUMAN) Sequence A:  MKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRS KKPSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHML IQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRG LRYIHSMSLVHMDIKPSNIFISKVMFKIGDLGHVTRISSP QVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGA EPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPD PERRPSAMALVKHSVL Description Functional site 1) chain A residue 305 type sequence I description BINDING SITE FOR RESIDUE 839 A 901 source : AC1 2) chain A residue 326 type sequence A description BINDING SITE FOR RESIDUE 839 A 901 source : AC1 3) chain A residue 328 type sequence K description BINDING SITE FOR RESIDUE 839 A 901 source : AC1 4) chain A residue 346 type sequence E description BINDING SITE FOR RESIDUE 839 A 901 source : AC1 5) chain A residue 360 type sequence V description BINDING SITE FOR RESIDUE 839 A 901 source : AC1 6) chain A residue 376 type sequence N description BINDING SITE FOR RESIDUE 839 A 901 source : AC1 7) chain A residue 377 type sequence E description BINDING SITE FOR RESIDUE 839 A 901 source : AC1 8) chain A residue 378 type sequence Y description BINDING SITE FOR RESIDUE 839 A 901 source : AC1 9) chain A residue 379 type sequence C description BINDING SITE FOR RESIDUE 839 A 901 source : AC1 10) chain A residue 382 type sequence G description BINDING SITE FOR RESIDUE 839 A 901 source : AC1 11) chain A residue 430 type sequence S description BINDING SITE FOR RESIDUE 839 A 901 source : AC1 12) chain A residue 433 type sequence F description BINDING SITE FOR RESIDUE 839 A 901 source : AC1 13) chain A residue 463 type sequence D description BINDING SITE FOR RESIDUE 839 A 901 source : AC1 14) chain A residue 426 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159, ECO:0000255|PROSITE-ProRule:PRU10027 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 305 type BINDING sequence I description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 16) chain A residue 328 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 17) chain A residue 307 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI4 18) chain A residue 305-328 type prosite sequence IGSGEFGSVFKCVKRLDGCIYAIK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. IGSGEFGSVFkCvkrldgci..........YAIK source prosite : PS00107 19) chain A residue 422-434 type prosite sequence LVHMDIKPSNIFI description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. LvHmDIKpsNIFI source prosite : PS00108 20) chain A residue 312 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:18691976, ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI5 21) chain A residue 342 type BINDING sequence N description BINDING => ECO:0000269|PubMed:15837193 source Swiss-Prot : SWS_FT_FI3 22) chain A residue 431 type BINDING sequence N description BINDING => ECO:0000269|PubMed:15837193 source Swiss-Prot : SWS_FT_FI3 23) chain A residue 463 type BINDING sequence D description BINDING => ECO:0000269|PubMed:15837193 source Swiss-Prot : SWS_FT_FI3 24) chain A residue 465 type BINDING sequence G description BINDING => ECO:0000269|PubMed:15837193 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links