eF-site ID 1qyx-A PDB Code 1qyx Chain A click to enlarge Title Crystal structure of human estrogenic 17beta-hydroxysteroid dehydrogenase complex with androstenedione and NADP Classification OXIDOREDUCTASE Compound Estradiol 17 beta-dehydrogenase 1 Source ORGANISM_COMMON: human; ORGANISM_SCIENTIFIC: Homo sapiens; Sequence A:  ARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLK TQGRLWEAARALACPPGSLETLQLDVRDSKSVAAARERVT EGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVR MLQAFLPDMKRRGSGRVLVTGSVGGLMGLPFNDVYCASKF ALEGLCESLAVLLLPFGVHLSLIECGPVHTSPEEVLDRTD IHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAPK PTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFG Description Functional site 1) chain A residue 143 type sequence V description BINDING SITE FOR RESIDUE ASD A 500 source : AC1 2) chain A residue 187 type sequence P description BINDING SITE FOR RESIDUE ASD A 500 source : AC1 3) chain A residue 218 type sequence Y description BINDING SITE FOR RESIDUE ASD A 500 source : AC1 4) chain A residue 221 type sequence H description BINDING SITE FOR RESIDUE ASD A 500 source : AC1 5) chain A residue 222 type sequence S description BINDING SITE FOR RESIDUE ASD A 500 source : AC1 6) chain A residue 259 type sequence F description BINDING SITE FOR RESIDUE ASD A 500 source : AC1 7) chain A residue 282 type sequence E description BINDING SITE FOR RESIDUE ASD A 500 source : AC1 8) chain A residue 9 type sequence G description BINDING SITE FOR RESIDUE NAP A 361 source : AC2 9) chain A residue 11 type sequence S description BINDING SITE FOR RESIDUE NAP A 361 source : AC2 10) chain A residue 12 type sequence S description BINDING SITE FOR RESIDUE NAP A 361 source : AC2 11) chain A residue 13 type sequence G description BINDING SITE FOR RESIDUE NAP A 361 source : AC2 12) chain A residue 37 type sequence R description BINDING SITE FOR RESIDUE NAP A 361 source : AC2 13) chain A residue 64 type sequence L description BINDING SITE FOR RESIDUE NAP A 361 source : AC2 14) chain A residue 65 type sequence D description BINDING SITE FOR RESIDUE NAP A 361 source : AC2 15) chain A residue 66 type sequence V description BINDING SITE FOR RESIDUE NAP A 361 source : AC2 16) chain A residue 67 type sequence R description BINDING SITE FOR RESIDUE NAP A 361 source : AC2 17) chain A residue 91 type sequence A description BINDING SITE FOR RESIDUE NAP A 361 source : AC2 18) chain A residue 92 type sequence G description BINDING SITE FOR RESIDUE NAP A 361 source : AC2 19) chain A residue 113 type sequence V description BINDING SITE FOR RESIDUE NAP A 361 source : AC2 20) chain A residue 252 type sequence R description BINDING SITE FOR RESIDUE GOL A 600 source : AC3 21) chain A residue 266 type sequence R description BINDING SITE FOR RESIDUE GOL A 600 source : AC3 22) chain A residue 269 type sequence D description BINDING SITE FOR RESIDUE GOL A 600 source : AC3 23) chain A residue 270 type sequence P description BINDING SITE FOR RESIDUE GOL A 600 source : AC3 24) chain A residue 156 type ACT_SITE sequence C description Proton acceptor source Swiss-Prot : SWS_FT_FI1 25) chain A residue 10 type BINDING sequence C description BINDING => ECO:0000269|PubMed:8805577 source Swiss-Prot : SWS_FT_FI2 26) chain A residue 66 type BINDING sequence V description BINDING => ECO:0000269|PubMed:8805577 source Swiss-Prot : SWS_FT_FI2 27) chain A residue 143 type BINDING sequence V description BINDING => ECO:0000269|PubMed:8805577 source Swiss-Prot : SWS_FT_FI2 28) chain A residue 160 type BINDING sequence F description BINDING => ECO:0000269|PubMed:8805577 source Swiss-Prot : SWS_FT_FI2 29) chain A residue 135 type MOD_RES sequence G description Phosphoserine; by PKA => ECO:0000269|PubMed:8994190 source Swiss-Prot : SWS_FT_FI3 30) chain A residue 142-170 type prosite sequence SVGGLMGLPFNDVYCASKFALEGLCESLA description ADH_SHORT Short-chain dehydrogenases/reductases family signature. SvgglmglpfNdvYCASKFALeGLCeSLA source prosite : PS00061

Display surface Download Links