eF-site ID 1mtb-A PDB Code 1mtb Chain A click to enlarge Title Viability of a drug-resistant HIV-1 protease mutant: structural insights for better antiviral therapy Classification HYDROLASE/HYDROLASE INHIBITOR Compound PROTEASE RETROPEPSIN Source Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) (HIV-1) (POL_HV1A2) Sequence A:  PQITLWQRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPG KWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPT PVNIIGRNLLTQIGCTLNF Description Functional site 1) chain A residue 6 type sequence W description BINDING SITE FOR RESIDUE QNC A 100 source : AC1 2) chain A residue 27 type sequence G description BINDING SITE FOR RESIDUE QNC A 100 source : AC1 3) chain A residue 28 type sequence A description BINDING SITE FOR RESIDUE QNC A 100 source : AC1 4) chain A residue 29 type sequence D description BINDING SITE FOR RESIDUE QNC A 100 source : AC1 5) chain A residue 48 type sequence G description BINDING SITE FOR RESIDUE QNC A 100 source : AC1 6) chain A residue 30 type sequence D description BINDING SITE FOR RESIDUE ASN A 101 source : AC2 7) chain A residue 47 type sequence I description BINDING SITE FOR RESIDUE ASN A 101 source : AC2 8) chain A residue 48 type sequence G description BINDING SITE FOR RESIDUE ASN A 101 source : AC2 9) chain A residue 25 type sequence N description BINDING SITE FOR RESIDUE HPH A 102 source : AC3 10) chain A residue 27 type sequence G description BINDING SITE FOR RESIDUE HPH A 102 source : AC3 11) chain A residue 49 type sequence G description BINDING SITE FOR RESIDUE HPH A 102 source : AC3 12) chain A residue 50 type sequence I description BINDING SITE FOR RESIDUE HPH A 102 source : AC3 13) chain A residue 25 type sequence N description BINDING SITE FOR RESIDUE DIQ B 100 source : AC4 14) chain A residue 81 type sequence P description BINDING SITE FOR RESIDUE DIQ B 100 source : AC4 15) chain A residue 78 type SITE sequence G description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 78 type MOD_RES sequence G description Phosphotyrosine; by host => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links