keyword:{{{1}}}
Go to Status search
PDBID:6i45
Status:PROC -- to be processed
Title:Crystal structure of I13V/I62V/V77I South African HIV-1 subtype C protease containing a D25A mutation
Authors:Sherry, D., Pandian, R., Achilonu, I.A., Dirr, H.W., Sayed, Y.
Deposition date:2018-11-09
PDBID:6i47
Status:PROC -- to be processed
Title:Structure of P. aeruginosa LpxC with compound 10: (2RS)-4-(5-(2-Fluoro-4-methoxyphenyl)-1-oxoisoindolin-2-yl)-N-hydroxy-2-methyl-2-(methylsulfonyl)butanamide
Authors:Surivet, J.-P., Panchaud, P., Specklin, J.-L., Diethelm, S., Blumstein, A.-C., Gauvin, J.-C., Jacob, L., Masse, F., Mathieu, G., Mirre, A., Schmitt, C., Enderlin-Paput, M., Lange, R., Bur, D., Tidten-Luksch, N., Gnerre, C., Seeland, S., Hermann, C., Locher, H.H., Seiler, P., Mac Sweeney, A., Hubschwerlen, C., Ritz, D., Rueedi, G.
Deposition date:2018-11-09
PDBID:6i48
Status:PROC -- to be processed
Title:Structure of P. aeruginosa LpxC with compound 12: (2R)-4-(6-(2-Fluoro-4-methoxyphenyl)-3-oxo-1H-pyrrolo[1,2-c]imidazol-2(3H)-yl)-N-hydroxy-2-methyl-2-(methylsulfonyl)butanamide
Authors:Surivet, J.-P., Panchaud, P., Specklin, J.-L., Diethelm, S., Blumstein, A.-C., Gauvin, J.-C., Jacob, L., Masse, F., Mathieu, G., Mirre, A., Schmitt, C., Enderlin-Paput, M., Lange, R., Bur, D., Tidten-Luksch, N., Gnerre, C., Seeland, S., Hermann, C., Locher, H.H., Seiler, P., Mac Sweeney, A., Hubschwerlen, C., Ritz, D., Rueedi, G.
Deposition date:2018-11-09
PDBID:6i49
Status:PROC -- to be processed
Title:Structure of P. aeruginosa LpxC with compound 17a: (2R)-N-Hydroxy-2-methyl-2-(methylsulfonyl)-4(6((4(morpholinomethyl)phenyl)ethynyl)-3-oxo-1H-pyrrolo[1,2-c]imidazol-2(3H)yl)butanamide
Authors:Surivet, J.-P., Panchaud, P., Specklin, J.-L., Diethelm, S., Blumstein, A.-C., Gauvin, J.-C., Jacob, L., Masse, F., Mathieu, G., Mirre, A., Schmitt, C., Enderlin-Paput, M., Lange, R., Bur, D., Tidten-Luksch, N., Gnerre, C., Seeland, S., Hermann, C., Locher, H.H., Seiler, P., Mac Sweeney, A., Hubschwerlen, C., Ritz, D., Rueedi, G.
Deposition date:2018-11-09
PDBID:6i4a
Status:PROC -- to be processed
Title:Structure of P. aeruginosa LpxC with compound 18d: (2R)-N-Hydroxy-4-(6-((1-(hydroxymethyl)cyclopropyl)buta-1,3-diyn-1-yl)-3-oxo-1H-pyrrolo[1,2-c]imidazol-2(3H)-yl)-2-methyl-2-(methylsulfonyl)butanamide
Authors:Surivet, J.-P., Panchaud, P., Specklin, J.-L., Diethelm, S., Blumstein, A.-C., Gauvin, J.-C., Jacob, L., Masse, F., Mathieu, G., Mirre, A., Schmitt, C., Enderlin-Paput, M., Lange, R., Bur, D., Tidten-Luksch, N., Gnerre, C., Seeland, S., Hermann, C., Locher, H.H., Seiler, P., Mac Sweeney, A., Hubschwerlen, C., Ritz, D., Rueedi, G.
Deposition date:2018-11-09
PDBID:6i3z
Status:AUTH -- processed, waiting for author review and approval
Title:Fab fragment of an antibody selective for wild-type alpha-1-antitrypsin in complex with its antigen
Authors:Laffranchi, M., Elliston, E.L.K., Miranda, E., Perez, J., Jagger, A.M., Fra, A., Lomas, D.A., Irving, J.A.
Deposition date:2018-11-08
PDBID:6n1c
Status:PROC -- to be processed
Title:Crystal structure of Inorganic pyrophosphatase from Legionella pneumophila Philadelphia 1
Authors:Seattle Structural Genomics Center for Infectious Disease (SSGCID)
Deposition date:2018-11-08
PDBID:6n1e
Status:PROC -- to be processed
Title:Crystal structure of X. citri phosphoglucomutase in complex with 1-methyl-glucose 6-phosphate
Authors:Beamer, L.J., Stiers, K.M.
Deposition date:2018-11-08
PDBID:6n0q
Status:AUTH -- processed, waiting for author review and approval
Title:BRAF in complex with N-(4-methyl-3-(1-methyl-2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)phenyl)-3-(trifluoromethyl)benzamide.
Authors:Mamo, M., Appleton, B.A.
Deposition date:2018-11-07
PDBID:6n0u
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of a glucose-1-phosphate thymidylyltransferase from Burkholderia phymatum bound to 2'-deoxy-thymidine-B-L-rhamnose
Authors:Seattle Structural Genomics Center for Infectious Disease (SSGCID)
Deposition date:2018-11-07
PDBID:6mzz
Status:AUTH -- processed, waiting for author review and approval
Title:Fluoroacetate dehalogenase, room temperature structure, using first 1 degree of total 3 degree oscillation
Authors:Finke, A.D., Wierman, J.L., Pare-Labrosse, O., Sarrachini, A., Besaw, J., Mehrabi, P., Gruner, S.M., Miller, R.J.D.
Deposition date:2018-11-06
PDBID:6n00
Status:HPUB -- hold until publication
Title:Fluoroacetate dehalogenase, room temperature structure, using last 1 degree of total 3 degree oscillation and 144 kGy dose
Authors:Finke, A.D., Wierman, J.L., Pare-Labrosse, O., Sarrachini, A., Besaw, J., Mehrabi, P., Gruner, S.M., Miller, R.J.D.
Deposition date:2018-11-06
Sequence:>Entity 1
GHMPDLADLFPGFGSEWINTSSGRIFARVGGDGPPLLLLHGFPQTHVMWHRVAPKLAERFKVIVADLPGYGWSDMPESDEQHTPYTKRAMAKQLIEAMEQLGHVHFALAGHDRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRAYALKIYHWSFLAQPAPLPENLLGGDPDFYVKAKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDYRAGAYADFEHDKIDVEAGNKIPVPMLALWGASGIAQSAATPLDVWRKWASDVQGAPIESGHFLPEEAPDQTAEALVRFFSAAPGS
PDBID:6n0a
Status:AUTH -- processed, waiting for author review and approval
Title:Structure of the major pilin protein (T-18.1) from Streptococcus pyogenes serotype MGAS8232
Authors:Young, P.G., Raynes, J.M., Loh, J.M., Proft, T., Baker, E.N., Moreland, N.J.
Deposition date:2018-11-06
PDBID:6mzi
Status:HPUB -- hold until publication
Title:CryoEM structure of human enterovirus D68 expanded 1 particle (pH 6.5, 4 degrees Celsius, 3 min)
Authors:Liu, Y., Rossmann, M.G.
Deposition date:2018-11-05
PDBID:6ipt
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of a fosfomycin and bleomycin resistant protein from Anabaena/Nostoc cyanobacterium at 1.70 A resolution
Authors:Chatterjee, A., Singh, P.K., Singh, T.P., Marina, A., Sharma, S., Rai, L.C.
Deposition date:2018-11-04
PDBID:6ip3
Status:PROC -- to be processed
Title:Structure of human telomeric DNA at 1.4 Angstroms resolution
Authors:Saikrishnan, K., Nuthanakanti, A., Srivatsan, S.G., Ahmad, I.
Deposition date:2018-11-01
PDBID:6mxu
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of hemagglutinin from A/Texas/1/1977 influenza virus
Authors:Dai, Y.N., Fremont, D.H., Center for Structural Genomics of Infectious Diseases (CSGID)
Deposition date:2018-10-31
PDBID:6mx3
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of human STING (G230A, H232R, R293Q) in complex with Compound 1
Authors:Lesburg, C.A., Siu, T., Ho, T.
Deposition date:2018-10-30
PDBID:6i1n
Status:AUTH -- processed, waiting for author review and approval
Title:Plasmodium falciparum spermidine synthase in complex with N-(3-aminopropyl)-trans-cyclohexane-1,4-diamine
Authors:Sprenger, J., Coertzen, D., Persson, L., Carey, J., Birkholtz, L.M., Louw, B.I.
Deposition date:2018-10-29
PDBID:6i1o
Status:HPUB -- hold until publication
Title:Fab fragment of an antibody selective for wild-type alpha-1-antitrypsin
Authors:Laffranchi, M., Elliston, E.L.K., Miranda, E., Perez, J., Fra, A., Lomas, D.A., Irving, J.A.
Deposition date:2018-10-29
PDBID:6mwa
Status:HPUB -- hold until publication
Title:NavAb Voltage-gated Sodium Channel, residues 1-239
Authors:Lenaeus, M.J., Catterall, W.A.
Deposition date:2018-10-29
PDBID:6mwb
Status:AUTH -- processed, waiting for author review and approval
Title:NavAb Voltage-gated Sodium Channel, residues 1-239 with mutation T206A
Authors:Lenaeus, M.J., Catterall, W.A.
Deposition date:2018-10-29
PDBID:6mwd
Status:AUTH -- processed, waiting for author review and approval
Title:NavAb Voltage-gated Sodium Channel, residues 1-239 with mutation T206S
Authors:Lenaeus, M.J., Catterall, W.A.
Deposition date:2018-10-29
PDBID:6mwg
Status:AUTH -- processed, waiting for author review and approval
Title:NavAb Voltage-gated Sodium Channel, residues 1-239, with mutation T206V
Authors:Lenaeus, M.J., Catterall, W.A.
Deposition date:2018-10-29
PDBID:6mvy
Status:HPUB -- hold until publication
Title:NavAb voltage-gated sodium channel, residues 1-226, crystallized in the presence of Class 1B Anti-arrhythmic drug Lidocaine
Authors:Lenaeus, M.J., Catterall, W.A.
Deposition date:2018-10-28
PDBj@FacebookPDBj@TwitterwwPDBwwPDB Foundation

Copyright © 2013-2018 Protein Data Bank Japan