| PDBID: | 9nak | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to tRNA | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nam | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to Mango in the absence of ligand | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nap | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to Mango in the presence of TO1-biotin | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nas | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to disordered U1A stem loop | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9lv2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of H1 Haemagglutinin HN/18-HA2-L113S from Influenza A virus | | Authors: | Deng, G., Wei, X., Sun, H. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of mutant H1 Haemagglutinin HN/18-HA FPP from Influenza A virus | | Authors: | Deng, G., Wei, X., Sun, H. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9lv1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of H1 Haemagglutinin HN/18 from Influenza A virus | | Authors: | Deng, G., Wei, X., Sun, H. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9na1 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9nad | | Status: | HPUB -- hold until publication | | Title: | Human GSTO1-1 complexed with C5-1 | | Authors: | Oakley, A.J. | | Deposition date: | 2025-02-11 | | Sequence: | >Entity 1
SGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
|
|
| PDBID: | 9na7 | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iax | | Status: | HPUB -- hold until publication | | Title: | DNA-PK, LX4, XLF - Catalytic domain of L4 | | Authors: | Chaplin, A.K., Hall, C. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9iat | | Status: | HPUB -- hold until publication | | Title: | Bc8.121 Fab | | Authors: | Mechaly, A.E., Haouz, A., Beretta, M., Caillet-Saguy, C., Mouquet, H. | | Deposition date: | 2025-02-11 |
|
| PDBID: | 9n92 | | Status: | HPUB -- hold until publication | | Title: | High-resolution analysis of the human T-cell leukemia virus capsid protein reveals insights into immature particle morphology | | Authors: | Arndt, W.G., Ramezani, A., Talledge, N., Yu, G., Yang, H., Chen, B., Zhang, W., Mansky, L.M., Perilla, J.R. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n9b | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease V186F covalently bound to inhibitor GRL-051-22 at 1.60 A | | Authors: | Beechboard, S.N., Meadows, M.S., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-02-10 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFFDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9n8e | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of EBOV glycoprotein with modified HR1c (L579P) and HR2 stalk | | Authors: | Lee, Y.Z., Stanfield, R.L., Wilson, I.A., Zhu, J. | | Deposition date: | 2025-02-08 |
|
| PDBID: | 9n8f | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SUDV glycoprotein with modified HR1c (L579P) and HR2 stalk bound to CA45 Fab | | Authors: | Lee, Y.Z., Ward, A.B., Zhu, J. | | Deposition date: | 2025-02-08 |
|
| PDBID: | 9i9t | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Room-temperature structure of PBP2a at EuXFEL | | Authors: | Grieco, A., Botha, S., Martin-Garcia, J.M. | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9i9s | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Room temperature structure of PBP2a at the LCLS | | Authors: | Grieco, A., Botha, S., Martin-Garcia, J.M. | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9i9x | | Status: | HPUB -- hold until publication | | Title: | Human GABARAP in complex with artificial peptide IM-2 | | Authors: | Wilms, J.A., McDonald, I., Willbold, D., Kritzer, J.A., Weiergraeber, O.H. | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9ia3 | | Status: | HPUB -- hold until publication | | Title: | Bc8.108 Fab bound to preS2 peptide | | Authors: | Mechaly, A.E., Haouz, A., Beretta, M., Caillet-Saguy, C., Mouquet, H. | | Deposition date: | 2025-02-07 |
|
| PDBID: | 9ltx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a polyketide decarboxylase Abx(+)O from Actinomycetes sp. MA7150 | | Authors: | Luo, S., Zhu, C., Jiang, K., Qu, X. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7n | | Status: | HPUB -- hold until publication | | Title: | Glutarate L-2-hydroxylase Q184C mutant-5''-Mal-C6-AGCT DNA conjugate at 1.82 Angstrom resolution | | Authors: | Han, Z., Mirkin, C.A. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7m | | Status: | HPUB -- hold until publication | | Title: | Designed anti-OSM Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Hofmann, J.L., Watkins, A.M., Seeger, F., Dou, Y., Zhang, X. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7o | | Status: | HPUB -- hold until publication | | Title: | Designed anti-OSM Fab | | Authors: | Kiefer, J.R., Alberstein, R.G., Hofmann, J.L., Watkins, A.M., Seeger, F., Dou, Y., Zhang, X. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7u | | Status: | HPUB -- hold until publication | | Title: | Glutarate L-2-hydroxylase Q184C mutant-5''-Mal-C2-AGCT DNA conjugate at 2.17 Angstrom resolution | | Authors: | Han, Z., Mirkin, C.A. | | Deposition date: | 2025-02-06 |
|
