PDBID: | 8t8j | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-22 | Release date: | 2024-12-18 |
|
PDBID: | 8pik | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-21 | Release date: | 2024-12-21 |
|
PDBID: | 8jti | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-21 | Release date: | 2024-12-21 |
|
PDBID: | 8t7r | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of human leukocyte antigen A*0101 in complex with the Fab of alloreactive antibody E07 | Authors: | Green, T.J., Killian Jr, J.T., Qiu, S., Macon, K.J., Yang, G., King, R.G., Lund, F.E. | Deposition date: | 2023-06-21 | Release date: | 2024-12-21 |
|
PDBID: | 8jsq | Status: | AUCO -- author corrections pending review | Deposition date: | 2023-06-20 |
|
PDBID: | 8phm | Status: | HPUB -- hold until publication | Title: | Oxalate-bound cobalt(II) human carbonic anhydrase II | Authors: | Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C. | Deposition date: | 2023-06-20 | Release date: | 2024-12-20 | Sequence: | >Entity 1 NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
PDBID: | 8jsr | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-20 | Release date: | 2024-09-25 |
|
PDBID: | 8phh | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Cryo-EM structure of Atkinsonella Hypoxylon Virus-like particles. | Authors: | Byrne, M.J., Sainsbury, F. | Deposition date: | 2023-06-19 |
|
PDBID: | 8jse | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-19 | Release date: | 2024-12-19 |
|
PDBID: | 8jsa | Status: | AUCO -- author corrections pending review | Deposition date: | 2023-06-19 |
|
PDBID: | 8phc | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-19 | Release date: | 2024-12-19 |
|
PDBID: | 8js2 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-18 | Release date: | 2024-12-18 |
|
PDBID: | 8jry | Status: | WAIT -- processing started, waiting for author input to continue processing | Deposition date: | 2023-06-18 |
|
PDBID: | 8pg1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-17 | Release date: | 2024-12-17 |
|
PDBID: | 8jrt | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-17 | Release date: | 2024-12-17 |
|
PDBID: | 8pfs | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-16 | Release date: | 2024-12-16 |
|
PDBID: | 8jri | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-16 | Release date: | 2024-12-16 |
|
PDBID: | 8jrh | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-16 | Release date: | 2024-12-16 |
|
PDBID: | 8jrf | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-16 | Release date: | 2024-12-16 |
|
PDBID: | 8jr7 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-16 | Release date: | 2024-12-25 |
|
PDBID: | 8jra | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-16 | Release date: | 2024-12-25 |
|
PDBID: | 8jrg | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-16 | Release date: | 2024-12-16 |
|
PDBID: | 8jr6 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-16 | Release date: | 2024-12-25 |
|
PDBID: | 8jr8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-16 | Release date: | 2024-12-16 |
|
PDBID: | 8t6m | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-16 | Release date: | 2024-12-21 |
|