| PDBID: | 8ric | | Status: | HPUB -- hold until publication | | Title: | Crystallographic structure of oligosaccharide dehydrogenase from Pycnoporus cinnabarinus bound to Sinapic Acid, tetragonal crystal | | Authors: | Savino, C., Sciara, G., Gugole, E., Vallone, B., Fata, F., Bulfaro, G., Costanzo, A., Montemiglio, L.C. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8rid | | Status: | HPUB -- hold until publication | | Title: | Crystallographic structure of oligosaccharide dehydrogenase from Pycnoporus cinnabarinus bound to Sinapic Acid, orthorhombic crystal | | Authors: | Savino, C., Sciara, G., Gugole, E., Vallone, B., Fata, F., Bulfaro, G., Costanzo, A., Montemiglio, L.C. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8rie | | Status: | HPUB -- hold until publication | | Title: | Crystallographic structure of oligosaccharide dehydrogenase from Pycnoporus cinnabarinus bound to Guaiacol, orthorhombic crystal | | Authors: | Savino, C., Sciara, G., Gugole, E., Vallone, B., Fata, F., Bulfaro, G., Costanzo, A., Montemiglio, L.C. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8ved | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8vef | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8vee | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8vdx | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of bacterial extracellular solute-binding protein from Bordetella bronchiseptica RB50 | | Authors: | Chang, C., Tesar, C., Endres, M., Joachimiak, A., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2023-12-18 | | Release date: | 2024-12-18 |
|
| PDBID: | 8vdv | | Status: | HOLD -- hold until a certain date | | Title: | pcsk9 in complex with inhibitor | | Authors: | Xu, M., Chopra, R. | | Deposition date: | 2023-12-18 | | Release date: | 2024-12-18 |
|
| PDBID: | 8veg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8vea | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8veb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8xhs | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8xhv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8xhw | | Status: | HOLD -- hold until a certain date | | Title: | Haloquadratum walsbyi middle rhodopsin mutant - D84N | | Authors: | Ko, L.N., Lim, G.Z., Yang, C.S. | | Deposition date: | 2023-12-18 | | Release date: | 2024-12-18 |
|
| PDBID: | 8xhn | | Status: | HOLD -- hold until a certain date | | Title: | Streptococcus pneumoniae-BceAB-ADP-Peptidisc Sample. | | Authors: | He, Y., Li, J., Luo, M. | | Deposition date: | 2023-12-18 | | Release date: | 2024-12-18 |
|
| PDBID: | 8xhq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8xhp | | Status: | HPUB -- hold until publication | | Title: | The apo structure of SsBcmC | | Authors: | Wu, L., Tang, G.L., Zhou, J.H. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8xhl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8xht | | Status: | HPUB -- hold until publication | | Title: | The apo structure of PaBcmG | | Authors: | Wu, L., Tang, G.L., Zhou, J.H. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8xhx | | Status: | HPUB -- hold until publication | | Title: | The complex structure of PaBcmG and its natural substrate | | Authors: | Wu, L., Tang, G.L., Zhou, J.H. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8xhy | | Status: | HPUB -- hold until publication | | Title: | The complex structure of mutant T307A of SsBcmE and its natural substrate cIL | | Authors: | Wu, L., Tang, G.L., Zhou, J.H. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8xhz | | Status: | HPUB -- hold until publication | | Title: | protein-DNA complex | | Authors: | Li, Z. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8xhm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-18 | | Release date: | 2024-12-18 |
|
| PDBID: | 8rhy | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P34 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8rhv | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P30 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
