| PDBID: | 8uyz | | Status: | HPUB -- hold until publication | | Title: | HBV Cp149 capsid protein (HBV dimer co-assembled with triton X-100) | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
|
|
| PDBID: | 8uzc | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of UT14 Fab in complex with the head domain of H3 (A/Singapore/INFIMH-16-0019/2016) | | Authors: | Park, J., Georgiou, G. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8uz3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8uyr | | Status: | HPUB -- hold until publication | | Title: | Manganese-substituted DitZ from Rhodococcus Rhodochrous | | Authors: | Liu, C., Chen, S., Rittle, J. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8uz2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x3l | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-14 | | Release date: | 2024-11-14 |
|
| PDBID: | 8x3t | | Status: | HPUB -- hold until publication | | Title: | Structure of LGR4 with NB21 | | Authors: | Wang, L., Geng, Y. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x42 | | Status: | HPUB -- hold until publication | | Title: | Complex structure of AtHPPD with YH20195 | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x3x | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-14 | | Release date: | 2024-11-14 |
|
| PDBID: | 8x3y | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-14 | | Release date: | 2024-11-14 |
|
| PDBID: | 8x3z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x3o | | Status: | HOLD -- hold until a certain date | | Title: | Structure of Cyclic Rev | | Authors: | Kim, D., Lim, Y., Barnwal, R.P. | | Deposition date: | 2023-11-14 | | Release date: | 2024-11-14 |
|
| PDBID: | 8x3m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of p38alpha with an allosteric inhibitor 2 | | Authors: | Hasegawa, S., Kinoshita, T. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x3q | | Status: | HPUB -- hold until publication | | Title: | tll1591 with alpha-glucan 4sugar | | Authors: | Su, J.Y. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x3p | | Status: | HOLD -- hold until a certain date | | Title: | Structure of linear Rev | | Authors: | Kim, D., Lim, Y., Barnwal, R.P. | | Deposition date: | 2023-11-14 | | Release date: | 2024-11-14 |
|
| PDBID: | 8x3u | | Status: | HPUB -- hold until publication | | Title: | tll1591 with alpha_glucan 3sugar | | Authors: | Su, J.Y. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8r52 | | Status: | HPUB -- hold until publication | | Title: | The complex of Glycogen Phosphorylase with epigallocatechin (EGC). | | Authors: | Alexopoulos, S., Papakostopoulou, S., Koulas, M.S., Leonidas, D.D., Skamnaki, V. | | Deposition date: | 2023-11-15 | | Release date: | 2025-05-15 |
|
| PDBID: | 8r53 | | Status: | HPUB -- hold until publication | | Title: | The complex of Glycogen Phosphorylase with (-)-Epigallocatechin-3-gallate (EGCG) and glucose. | | Authors: | Alexopoulos, S., Papakostopoulou, S., Koulas, M.S., Leonidas, D.D., Skamnaki, V. | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8uzg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-15 | | Release date: | 2025-05-16 |
|
| PDBID: | 8x4k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8x4m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8x4n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the PI3P-binding domain of Legionella SetA in complex with inositol 1,3-bisphosphate | | Authors: | Im, H.N., Lee, Y., Jang, D.M., Hahn, H., Kim, H.S. | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8x4d | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (TM helix S0,20 uM Ca2+, 2 mM ATP) | | Authors: | Chen, Q., Hu, H. | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8x4u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8x4e | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (TM helix S0, 5 mM Ca2+) | | Authors: | Chen, Q., Hu, H. | | Deposition date: | 2023-11-15 |
|
