PDBID: | 8wub | Status: | HPUB -- hold until publication | Title: | The X-ray structure of human neuroglobin C120S mutant | Authors: | Lin, Y.W., Yuan, H. | Deposition date: | 2023-10-20 |
|
PDBID: | 8wuj | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of A. thaliana H2A.W nucleosome | Authors: | Liu, X., Gong, Q.Y. | Deposition date: | 2023-10-20 |
|
PDBID: | 8wuh | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of A. thaliana canonical H2A.13 nucleosome | Authors: | Liu, X., Gong, Q.Y. | Deposition date: | 2023-10-20 |
|
PDBID: | 8qx3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-21 |
|
PDBID: | 8up5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-21 | Release date: | 2025-04-20 |
|
PDBID: | 8wur | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of SARS-Cov-2 main protease D48N mutant in complex with shikonin | Authors: | Zhao, Z.Y., Li, W.W., Zhang, J., Li, J. | Deposition date: | 2023-10-21 | Release date: | 2024-10-21 |
|
PDBID: | 8qx4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-22 |
|
PDBID: | 8wv0 | Status: | HPUB -- hold until publication | Title: | Outer membrane porin of Burkholderia pseudomallei (BpsOmp38) | Authors: | Bunkum, P., Aunkham, A., Bert van den, B., Robinson, R.C., Suginta, W. | Deposition date: | 2023-10-22 |
|
PDBID: | 8wv1 | Status: | HPUB -- hold until publication | Title: | Ambient Temperature Structure of 50S Ribosomal Subunit from Thermus Thermophilus | Authors: | DeMirci, H., Tosun, B. | Deposition date: | 2023-10-22 |
|
PDBID: | 8wuz | Status: | HPUB -- hold until publication | Title: | Development of 2-imino-2,3,5,6,7,8-hexahydropyrido[4,3-d]pyrimidin-4(1H)-one derivatives as human caseinolytic peptidase P (hClpP) activators | Authors: | Jiang, J.-X., Ding, H., Chen, M.-R., Lu, M.-L., Sun, H.-Y., Xiao, Y.-B. | Deposition date: | 2023-10-22 |
|
PDBID: | 8wv2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-22 | Sequence: | >Entity 1 MLTDNWKELAGKAQSTFQKSLKQAIELADFDEGLAKRYGALPSAIGANVEDFGSPAQFPLEEYLKALPKKVLDITEKDPVELLKDLKSRKVTCVEVLKAYTAASIVASKLTNCVQEFLPIEALQYAQKLDADYETKKHLPLYGLPFSIKEMIPFVGRSVTHGSLCYLDRIVDYNADIVNILIANGAYPFVRTTNPQSLMMLECVSFSHGRTVNAYNGMLTSGGSSGGEGALNGMRASPFGLGSDIGGSIRCPAAFNGIYGLRSTLGRIPTADYFSCNRGSESILSVTGPLSRSLDTVNLVMKTVIEAKPWLIDPTLVPLDWKRPENKKFRVGIYVSDHIVNPSPPINRALSMVTEKLKSLGNFEVVTFEPYKPEKVTEILGKLYFEDGARDFRATLQTGEPLLEQTRWAIEGAEDLDMHDQWYWNLQKQAYRKEFLKHWCSYTDNDGNVLDAVIAPVFPNVAAKHETTKYWTYTSQWNLLDYPVLAFPVTKVDESLDQPYKNYKPLNDLDKYFYEQYDSPSSFKNAPANLCLVGLRFTDEKLVEIANILRN
|
|
PDBID: | 8upz | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-23 |
|
PDBID: | 8uq0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-23 |
|
PDBID: | 8uq1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-23 |
|
PDBID: | 8uqh | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-23 | Release date: | 2025-04-20 |
|
PDBID: | 8uqf | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-23 |
|
PDBID: | 8wv3 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-10-23 | Release date: | 2024-10-23 |
|
PDBID: | 8wv7 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-10-23 |
|
PDBID: | 8wva | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-23 |
|
PDBID: | 8wv9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-23 |
|
PDBID: | 8wvc | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-23 |
|
PDBID: | 8wvj | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-23 |
|
PDBID: | 8wvi | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-23 |
|
PDBID: | 8wvh | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-23 |
|
PDBID: | 8qxr | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-10-24 | Release date: | 2024-10-24 |
|