PDBID: | 9gq2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gq3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 | Sequence: | >Entity 1 GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEIAHLLIKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
|
|
PDBID: | 9gq5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gq6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gq7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gqe | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gqf | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gqj | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gqk | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gq9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gqi | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gqg | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gqh | Status: | HPUB -- hold until publication | Deposition date: | 2024-09-09 |
|
PDBID: | 9gqt | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-09 |
|
PDBID: | 9gqr | Status: | HPUB -- hold until publication | Title: | Structure of a consensus-designed decarboxylase (PSC1) | Authors: | Gavira, J.A., Ramos, J.L., Garcia-Franco, A., de la Torre, J. | Deposition date: | 2024-09-09 |
|
PDBID: | 9gqu | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-09 |
|
PDBID: | 9gqv | Status: | HPUB -- hold until publication | Title: | Pseudomonas aeruginosa FabF C164A in complex with N-((1-((2-hydroxy-4-methylpentanamido)methyl)cyclobutyl)methyl)-1H-pyrazole-3-carboxamide | Authors: | Yadrykhins''ky, V., Brenk, R. | Deposition date: | 2024-09-09 |
|
PDBID: | 9gq0 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-09 |
|
PDBID: | 9gqn | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM map of dimeric AvrSr35 | Authors: | Macha, A., Gunkel, M., Lawson, A.W., Schulze-Lefert, P., Behrmann, E. | Deposition date: | 2024-09-09 |
|
PDBID: | 9jh6 | Status: | PROC -- to be processed | Title: | Activation mechanism of CYSLTR2 by C20:0 | Authors: | Wang, J.L., Sun, J.P., Yu, X. | Deposition date: | 2024-09-09 |
|
PDBID: | 9jh5 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Activation mechanism of GPR132 by compound NOX-6-7 | Authors: | Wang, J.L., Ding, J.H., Sun, J.P., Yu, X. | Deposition date: | 2024-09-09 |
|
PDBID: | 9jh7 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-09-09 |
|
PDBID: | 9jh8 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-09-09 |
|
PDBID: | 9jhf | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-em structure of beta-LG fibril | Authors: | Xu, Y.Y., Liu, C. | Deposition date: | 2024-09-09 |
|
PDBID: | 9jh9 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-09-09 |
|