| PDBID: | 9gq2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9gq3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-09 | | Sequence: | >Entity 1
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEIAHLLIKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
|
|
| PDBID: | 9gq5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9gq6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9gq7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9gqe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9gqf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9gqj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9gqk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9gq9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9gqi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9gqg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9gqh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9gqt | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9gqr | | Status: | HPUB -- hold until publication | | Title: | Structure of a consensus-designed decarboxylase (PSC1) | | Authors: | Gavira, J.A., Ramos, J.L., Garcia-Franco, A., de la Torre, J. | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9gqu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9gqv | | Status: | HPUB -- hold until publication | | Title: | Pseudomonas aeruginosa FabF C164A in complex with N-((1-((2-hydroxy-4-methylpentanamido)methyl)cyclobutyl)methyl)-1H-pyrazole-3-carboxamide | | Authors: | Yadrykhins''ky, V., Brenk, R. | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9gq0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9gqn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM map of dimeric AvrSr35 | | Authors: | Macha, A., Gunkel, M., Lawson, A.W., Schulze-Lefert, P., Behrmann, E. | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9jh6 | | Status: | PROC -- to be processed | | Title: | Activation mechanism of CYSLTR2 by C20:0 | | Authors: | Wang, J.L., Sun, J.P., Yu, X. | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9jh5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Activation mechanism of GPR132 by compound NOX-6-7 | | Authors: | Wang, J.L., Ding, J.H., Sun, J.P., Yu, X. | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9jh7 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9jh8 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9jhf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-em structure of beta-LG fibril | | Authors: | Xu, Y.Y., Liu, C. | | Deposition date: | 2024-09-09 |
|
| PDBID: | 9jh9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-09 |
|
