| PDBID: | 9cr8 | | Status: | HPUB -- hold until publication | | Title: | SapNP reconstituted human ABCB1 | | Authors: | Kurre, D., Alam, A. | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9cr9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9cra | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9iuf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-21 |
|
| PDBID: | 9g7d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ASGPR with bound IMP | | Authors: | Schreuder, H.A., Hofmeister, A. | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9g7e | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ASGPR with bound guanosine | | Authors: | Schreuder, H.A., Hofmeister, A. | | Deposition date: | 2024-07-20 | | Sequence: | >Entity 1
MGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLLGSHHHHHH
|
|
| PDBID: | 9g7c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9g7a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9g79 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9g7f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9g7b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9iud | | Status: | HPUB -- hold until publication | | Title: | High resolution structure of Lectin-Like ox-LDL Receptor 1 with BI-0115 in space group P 21 21 21 | | Authors: | Khan, M.A., Arulandu, A. | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9itf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9itk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9itl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9itm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9itn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9ito | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9itp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9itq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9itr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9its | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9itt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9itv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9itw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
