| PDBID: | 8qun | | Status: | HPUB -- hold until publication | | Title: | human carbonic anhydrase I in complex with 2-((5-cyano-4-hydroxy-6-(p-tolyl)pyrimidin-2-yl)thio)-N-(4-sulfamoylphenyl)acetamide | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-10-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8quo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 | | Release date: | 2025-04-16 |
|
| PDBID: | 8qup | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8qum | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8ulr | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the BG505 SOSIPv2 in complex with bNAb 05_B08 Fabs | | Authors: | DeLaitsch, A.T., Bjorkman, P.J. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ul9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8uls | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the BG505 SOSIPv2 in complex with bNAb 01_D03 Fabs | | Authors: | DeLaitsch, A.T., Bjorkman, P.J. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ult | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the BG505 SOSIPv2 in complex with bNAb 04_A06 Fabs | | Authors: | DeLaitsch, A.T., Bjorkman, P.J. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ul1 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ul0 | | Status: | HPUB -- hold until publication | | Title: | Structure of rsKiiro using SSX | | Authors: | Baxter, J.M., van Thor, J.J. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ul2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of rsKiiro using SSX after illumination with 0.53 mJ/mm^2 of 405 nm light | | Authors: | Baxter, J.M., van Thor, J.J. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ul3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of rsKiiro using SSX after illumination with 1.78 mJ/mm^2 of 405 nm light | | Authors: | Baxter, J.M., van Thor, J.J. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ul4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of rsKiiro using SSX after illumination with 6.74 mJ/mm^2 of 405 nm light | | Authors: | Baxter, J.M., van Thor, J.J. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ul5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of rsKiiro using SSX after illumination with 14.43 mJ/mm^2 of 405 nm light | | Authors: | Baxter, J.M., van Thor, J.J. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8uli | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ula | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Lmo2839 ABC transporter substrate binding protein | | Authors: | Ripley, B.M., Radoshevich, L. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ulu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the BG505 SOSIPv2 in complex with bNAb 04_A06 and PGDM1400 Fabs | | Authors: | DeLaitsch, A.T., Bjorkman, P.J. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ul6 | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST in complex with T16, long soaking | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ul8 | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST in complex with T15, short soaking | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ulb | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST in complex with T17, long soaking | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8uln | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ulc | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST in complex with T15, long soaking | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ulk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Prefusion RSV F bound by neutralizing antibody 1G12 | | Authors: | Harshbarger, W.D., Andreano, E., Malito, E. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ulj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Prefusion RSV F bound by neutralizing antibody 2E08 | | Authors: | Harshbarger, W.D., Andreano, E., Malito, E. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ulh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Fab of RSV neutralizing antibody 1G12 | | Authors: | Harshbarger, W.D., Andreano, E., Malito, E. | | Deposition date: | 2023-10-16 |
|
