PDBID: | 8tr6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8tr7 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8tra | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8trb | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8trk | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8trf | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2025-02-09 |
|
PDBID: | 8trh | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-09 | Release date: | 2025-02-05 |
|
PDBID: | 8tr8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 | Release date: | 2024-12-31 |
|
PDBID: | 8q55 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-08 | Release date: | 2025-02-08 |
|
PDBID: | 8q5c | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 12 (1075475) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-08-08 | Release date: | 2025-02-08 |
|
PDBID: | 8kd1 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2025-02-08 |
|
PDBID: | 8kcy | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2025-02-08 |
|
PDBID: | 8tqy | Status: | HPUB -- hold until publication | Title: | X-Ray Crystal Structure of a dihydromethanopterin reductase (DmrA) from Methylobacterium extorquens AM1 in a H32 Spacegroup at 2.19 Angstrom Resolution | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbig, M., Collazo, M., Potla, P.S. | Deposition date: | 2023-08-08 | Release date: | 2025-01-08 | Sequence: | >Entity 1 MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
PDBID: | 8tqw | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-08 | Release date: | 2025-02-05 |
|
PDBID: | 8q51 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-07 | Release date: | 2025-02-07 |
|
PDBID: | 8q4y | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-07 | Release date: | 2025-02-07 |
|
PDBID: | 8q4c | Status: | AUCO -- author corrections pending review | Title: | Human PEX5 TPR domain in complex with PEX14 KIPSWQIPV peptide | Authors: | Emmanouilidis, L., Gaussmann, S., Sattler, M. | Deposition date: | 2023-08-06 |
|
PDBID: | 8tq4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8tq5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8tq6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8tq2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8tqc | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-06 | Release date: | 2025-02-05 |
|
PDBID: | 8kbn | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-04 | Release date: | 2025-02-04 |
|
PDBID: | 8kbo | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-04 | Release date: | 2025-02-04 |
|
PDBID: | 8kbq | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-04 | Release date: | 2025-02-04 |
|