PDBID: | 9ir3 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Nipah virus L-P polymerase complex | Authors: | Shi, Y., Peng, Q. | Deposition date: | 2024-07-13 |
|
PDBID: | 9ir1 | Status: | HPUB -- hold until publication | Title: | Crystal structure of CTB10-M40BpA | Authors: | Fu, K., Rao, Y.J. | Deposition date: | 2024-07-13 |
|
PDBID: | 9iqz | Status: | HOLD -- hold until a certain date | Title: | phage HY126 glycosyltransferase | Authors: | Yu, H. | Deposition date: | 2024-07-13 | Release date: | 2025-07-13 |
|
PDBID: | 9ir0 | Status: | HOLD -- hold until a certain date | Title: | phage HY126 glycosyltransferase with UDP | Authors: | Yu, H. | Deposition date: | 2024-07-13 | Release date: | 2025-07-13 |
|
PDBID: | 9ir2 | Status: | HOLD -- hold until a certain date | Title: | phage HY126 hydroxylase | Authors: | Yu, H. | Deposition date: | 2024-07-13 | Release date: | 2025-07-13 |
|
PDBID: | 9cma | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-13 |
|
PDBID: | 9cm9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM model derived from localized reconstruction of Ad657-hexon-FX complex at 3.86A resolution | Authors: | Reddy, V.S., Ma, O.X. | Deposition date: | 2024-07-13 |
|
PDBID: | 9iqq | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-13 |
|
PDBID: | 9cm8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-13 |
|
PDBID: | 9iqu | Status: | HOLD -- hold until a certain date | Title: | phage HY126 hydroxylase-XAN60475 | Authors: | Yu, H. | Deposition date: | 2024-07-13 | Release date: | 2025-07-13 |
|
PDBID: | 9cmb | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-13 |
|
PDBID: | 9iqs | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of MT3-Muscarinic acetylcholine receptor 4 | Authors: | Zhong, Y.X., Tao, H.H., Tao, Y.Y. | Deposition date: | 2024-07-13 |
|
PDBID: | 9iqr | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Cryo-EM structure of MT3-alpha2AAR | Authors: | Zhong, Y.X., Tao, H.H., Tao, Y.Y. | Deposition date: | 2024-07-13 |
|
PDBID: | 9iqp | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-13 |
|
PDBID: | 9iqt | Status: | AUTH -- processed, waiting for author review and approval | Title: | structure of niacin-HCA2-Gi | Authors: | Liu, Y., Zhou, Z. | Deposition date: | 2024-07-13 |
|
PDBID: | 9iqo | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-13 |
|
PDBID: | 0585 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3v | Status: | HPUB -- hold until publication | Title: | Structure of the human nuclear cap-binding-complex (CBC) | Authors: | Martin, K., Hoh, F., Trapani, S., Tazi, J., Bron, P. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3j | Status: | HOLD -- hold until a certain date | Title: | Circularly permuted lumazine synthase twisted tube with 28 Angstrom gap between double strands | Authors: | Koziej, L., Azuma, Y. | Deposition date: | 2024-07-12 | Release date: | 2025-07-12 |
|
PDBID: | 9g3k | Status: | HPUB -- hold until publication | Title: | LecB from PA01 in complex with synthetic beta - fucosylamide | Authors: | Antonini, G., Varrot, A. | Deposition date: | 2024-07-12 | Sequence: | >Entity 1 ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
|
|
PDBID: | 9g40 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3z | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the Open gamma-Tubulin Ring Complex from Pig Brain | Authors: | Munoz-Hernandez, H., Wieczorek, M. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3y | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the Native CMG-decorated gamma-Tubulin Ring Complex from Pig Brain | Authors: | Munoz-Hernandez, H., Wieczorek, M. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3x | Status: | HPUB -- hold until publication | Title: | Structure of the Partially-assembled gamma-Tubulin Ring Complex from Pig Brain | Authors: | Munoz-Hernandez, H., Wieczorek, M. | Deposition date: | 2024-07-12 |
|
PDBID: | 9g3l | Status: | AUTH -- processed, waiting for author review and approval | Title: | LecB from PA01 in complex with synthetic beta - fucosylamide | Authors: | Antonini, G., Varrot, A. | Deposition date: | 2024-07-12 |
|