PDBID: | 9cr8 | Status: | HPUB -- hold until publication | Title: | SapNP reconstituted human ABCB1 | Authors: | Kurre, D., Alam, A. | Deposition date: | 2024-07-21 |
|
PDBID: | 9cr9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-21 |
|
PDBID: | 9cra | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-21 |
|
PDBID: | 9iuf | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-21 |
|
PDBID: | 9g7d | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of ASGPR with bound IMP | Authors: | Schreuder, H.A., Hofmeister, A. | Deposition date: | 2024-07-20 |
|
PDBID: | 9g7e | Status: | HPUB -- hold until publication | Title: | Crystal structure of ASGPR with bound guanosine | Authors: | Schreuder, H.A., Hofmeister, A. | Deposition date: | 2024-07-20 | Sequence: | >Entity 1 MGSERTCCPVNWVEHERSCYWFSRSGKAWADADNYCRLEDAHLVVVTSWEEQKFVQHHIGPVNTWMGLHDQNGPWKWVDGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAHFTDDGRWNDDVCQRPYRWVCETELDKASQEPPLLGSHHHHHH
|
|
PDBID: | 9g7c | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-20 |
|
PDBID: | 9g7a | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-20 |
|
PDBID: | 9g79 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-20 |
|
PDBID: | 9g7f | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-20 |
|
PDBID: | 9g7b | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-20 |
|
PDBID: | 9iud | Status: | HPUB -- hold until publication | Title: | High resolution structure of Lectin-Like ox-LDL Receptor 1 with BI-0115 in space group P 21 21 21 | Authors: | Khan, M.A., Arulandu, A. | Deposition date: | 2024-07-20 |
|
PDBID: | 9itf | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-20 |
|
PDBID: | 9itk | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-20 |
|
PDBID: | 9itl | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-20 |
|
PDBID: | 9itm | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-20 |
|
PDBID: | 9itn | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-20 |
|
PDBID: | 9ito | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-20 |
|
PDBID: | 9itp | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-20 |
|
PDBID: | 9itq | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-20 |
|
PDBID: | 9itr | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-20 |
|
PDBID: | 9its | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-20 |
|
PDBID: | 9itt | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-20 |
|
PDBID: | 9itv | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-20 |
|
PDBID: | 9itw | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-20 |
|