| PDBID: | 9ilp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Sturcture of the bacteriophage T5 portal complex | | Authors: | Peng, Y.N., Liu, H.R. | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9ily | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9ilz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9im1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9im2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9im3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9im0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9ilu | | Status: | HPUB -- hold until publication | | Title: | Unliganded structure of Nucleoside hydrolase 1 (NSH1) D29A mutant from Arabidopsis thaliana | | Authors: | Yoon, Y.B., Rhee, S.K., Byun, S.J. | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9ilt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of alternative complex III from Chloroflexus aurantiacus | | Authors: | Xu, X., Wu, W. | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9ils | | Status: | HOLD -- hold until a certain date | | Title: | The GmvT toxin in complex with the C-terminal fragment of its antitoxin | | Authors: | Xie, W., Chen, R., Zhao, H. | | Deposition date: | 2024-07-01 | | Release date: | 2025-07-01 |
|
| PDBID: | 9ilq | | Status: | HPUB -- hold until publication | | Title: | Small GTPase RhoA Y42C mutant in complex with covalent inhibitor | | Authors: | Wu, H., Jiang, H. | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9ilr | | Status: | HOLD -- hold until a certain date | | Title: | The structure of the GmvT-GmvA-AcCoA ternary complex | | Authors: | Xie, W., Chen, R., Zhao, H. | | Deposition date: | 2024-07-01 | | Release date: | 2025-07-01 |
|
| PDBID: | 9il6 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human glutaminase C in complex with Protoporphyrin IX (local refinement) | | Authors: | Sun, H., Zheng, Q., Jiang, B., Li, Q., Li, S. | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9ilw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the periplasmic domain of sensor protein EvgS from Escherichia coli str. K-12 substr. MG1655 | | Authors: | Teng, Y., Liu, R., Luo, B. | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9iln | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9ilo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CTB10-M4 | | Authors: | Fu, K., Rao, Y.J. | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9ilv | | Status: | HPUB -- hold until publication | | Title: | Structure of the bacteriophage T5 connector complex | | Authors: | Peng, Y.N., Liu, H.R. | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9ilx | | Status: | HPUB -- hold until publication | | Title: | Thanatin VF16QK in complex with LPS | | Authors: | Swaleeha, A., Bhattacharyya, S. | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9cho | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9cgy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9cgw | | Status: | HPUB -- hold until publication | | Title: | Structure of the alpha-N-methyltransferase (SonM) and RiPP precursor (SonA-I65W) heteromeric complex (no cofactor) | | Authors: | Crone, K.K., Labonte, J.W., Elias, M., Freeman, M.F. | | Deposition date: | 2024-07-01 | | Sequence: | >Entity 1
MGSLVCVGTGLQLAGQISVLSRSYIEHADIVFSLLPDGFSQRWLTKLNPNVINLQQFYAQNGEVKNRRDTYEQMVNAILDAVRAGKKTVCALYGHPGVFACVSHMAITRAKAEGFSAKMEPGISAEACLWADLGIDPGNSGHQSFEASQFMFFNHVPDPTTHLLLWQIAIAGEHTLTQFHTSSDRLQILVEQLNQWYPLDHEVVIYEAANLPIQAPRIERLPLANLPQAHLMPISTLLIPPAKKLEYNYAILAKLGIGPEDLG
>Entity 2
MHHHHHHMSGLSDFFTQLGQDAQLMEDYKQNPEAVMRAHGLTDEQINAVMTGDMEKLKTLSGDSSYQSYLVWSHGNGD
|
|
| PDBID: | 9cgv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9cgu | | Status: | HPUB -- hold until publication | | Title: | Cas9 ternary complex, 14-nt sgRNA, State II (kinked) | | Authors: | Kiernan, K.A., Simonovic, M. | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9cgx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-01 |
|
| PDBID: | 9chm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-01 |
|
