| PDBID: | 9iz9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | VLP structure of Chikungunya virus complexed with C37 Fab, 2f block. | | Authors: | Han, X., Ji, C., Wang, F., Tian, S., Gao, F.G., Yan, J. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izl | | Status: | HPUB -- hold until publication | | Title: | hVanin-1 complexed with X17 | | Authors: | Fan, S., Zhen, L., Xie, T. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
GSTVSAEDKAAAERSKEIDKCLSREKTYVKRLVKILLLGADNSGKSTFLKQMRIIHGGSGGSGGTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSVTSILFLVDSSDFNRLTESLNDFETIVNNRVFSNVSIILFLNKTDLLEEKVQIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENARLIFRDVKDTILHDNLKQLMLQ
>Entity 2
DVQLVESGGGLVQPGGSRKLSCSASGFAFSSFGMHWVRQAPEKGLEWVAYISSGSGTIYYADTVKGRFTISRDDPKNTLFLQMTSLRSEDTAMYYCVRSIYYYGSSPFDFWGQGTTLTVSSGGGGSGGGGSGGGGSDIVMTQATSSVPVTPGESVSISCRSSKSLLHSNGNTYLYWFLQRPGQSPQLLIYRMSNLASGVPDRFSGSGSGTAFTLTISRLEAEDVGVYYCMQHLEYPLTFGAGTKLELK
>Entity 3
MHHHHHHHHENLYFQGSSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWNGGSGGGGSGGSSSGGVSGWRLFKKIS
>Entity 4
SNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL
>Entity 5
MKTIIALSYIFCLVFADYKDDDDGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVARNSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASVFSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACSTVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLGVFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVLRPLGGSGGGGSGGSSSGGVFTLEDFVGDWEQTAAYNLDQVLEQGGVSSLLQNLAVSVTPIQRIVRSGENALKIDIHVIIPYEGLSADQMAQIEEVFKVVYPVDDHHFKVILPYGTLVIDGVTPNMLNYFGRPYEGIAVFDGKKITVTGTLWNGNKIIDERLITPDGSMLFRVTINS
|
|
| PDBID: | 9izm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-01 | | Release date: | 2025-08-01 |
|
| PDBID: | 9izc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-01 | | Release date: | 2025-08-01 |
|
| PDBID: | 9izv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HKU1A RBD bound to TMPRSS2 | | Authors: | Wang, W., Xu, Y., Zhang, S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9j00 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9j01 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9izy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
