| PDBID: | 8ww0 | | Status: | HPUB -- hold until publication | | Title: | Cyclic peptide with affinity for ICOS | | Authors: | Fan, S.H., Wu, C.L. | | Deposition date: | 2023-10-24 |
|
| PDBID: | 8upz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8uq0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8uq1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8uqh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 | | Release date: | 2025-04-20 |
|
| PDBID: | 8uqf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8wv3 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-23 | | Release date: | 2024-10-23 |
|
| PDBID: | 8wv7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8wva | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8wv9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8wvc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8wvj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8wvi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8wvh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8qx4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wv0 | | Status: | HPUB -- hold until publication | | Title: | Outer membrane porin of Burkholderia pseudomallei (BpsOmp38) | | Authors: | Bunkum, P., Aunkham, A., Bert van den, B., Robinson, R.C., Suginta, W. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wv1 | | Status: | HPUB -- hold until publication | | Title: | Ambient Temperature Structure of 50S Ribosomal Subunit from Thermus Thermophilus | | Authors: | DeMirci, H., Tosun, B. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wuz | | Status: | HPUB -- hold until publication | | Title: | Development of 2-imino-2,3,5,6,7,8-hexahydropyrido[4,3-d]pyrimidin-4(1H)-one derivatives as human caseinolytic peptidase P (hClpP) activators | | Authors: | Jiang, J.-X., Ding, H., Chen, M.-R., Lu, M.-L., Sun, H.-Y., Xiao, Y.-B. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wv2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 | | Sequence: | >Entity 1
MLTDNWKELAGKAQSTFQKSLKQAIELADFDEGLAKRYGALPSAIGANVEDFGSPAQFPLEEYLKALPKKVLDITEKDPVELLKDLKSRKVTCVEVLKAYTAASIVASKLTNCVQEFLPIEALQYAQKLDADYETKKHLPLYGLPFSIKEMIPFVGRSVTHGSLCYLDRIVDYNADIVNILIANGAYPFVRTTNPQSLMMLECVSFSHGRTVNAYNGMLTSGGSSGGEGALNGMRASPFGLGSDIGGSIRCPAAFNGIYGLRSTLGRIPTADYFSCNRGSESILSVTGPLSRSLDTVNLVMKTVIEAKPWLIDPTLVPLDWKRPENKKFRVGIYVSDHIVNPSPPINRALSMVTEKLKSLGNFEVVTFEPYKPEKVTEILGKLYFEDGARDFRATLQTGEPLLEQTRWAIEGAEDLDMHDQWYWNLQKQAYRKEFLKHWCSYTDNDGNVLDAVIAPVFPNVAAKHETTKYWTYTSQWNLLDYPVLAFPVTKVDESLDQPYKNYKPLNDLDKYFYEQYDSPSSFKNAPANLCLVGLRFTDEKLVEIANILRN
|
|
| PDBID: | 8qx3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-21 |
|
| PDBID: | 8up5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-21 | | Release date: | 2025-04-20 |
|
| PDBID: | 8wur | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of SARS-Cov-2 main protease D48N mutant in complex with shikonin | | Authors: | Zhao, Z.Y., Li, W.W., Zhang, J., Li, J. | | Deposition date: | 2023-10-21 | | Release date: | 2024-10-21 |
|
| PDBID: | 8qx1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8up2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uot | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-20 |
|
