eF-site ID 9ilb-A PDB Code 9ilb Chain A click to enlarge Title HUMAN INTERLEUKIN-1 BETA Classification SIGNALING PROTEIN Compound PROTEIN (HUMAN INTERLEUKIN-1 BETA) Source Homo sapiens (Human) (IL1B_HUMAN) Sequence A:  APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQV VFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNW YISTSQAENMPVFLGGTKGGQDITDFTMQFVSS Description Functional site 1) chain A residue 4 type SITE sequence R description Involved in receptor binding source Swiss-Prot : SWS_FT_FI1 2) chain A residue 55 type SITE sequence K description Important for interaction with integrin => ECO:0000269|PubMed:29030430 source Swiss-Prot : SWS_FT_FI2 3) chain A residue 63 type SITE sequence K description Important for interaction with integrin => ECO:0000269|PubMed:29030430 source Swiss-Prot : SWS_FT_FI2 4) chain A residue 65 type SITE sequence K description Important for interaction with integrin => ECO:0000269|PubMed:29030430 source Swiss-Prot : SWS_FT_FI2 5) chain A residue 74 type SITE sequence K description Important for interaction with integrin => ECO:0000269|PubMed:29030430 source Swiss-Prot : SWS_FT_FI2 6) chain A residue 88 type SITE sequence K description Important for interaction with integrin => ECO:0000269|PubMed:29030430 source Swiss-Prot : SWS_FT_FI2 7) chain A residue 112-132 type prosite sequence FESAQFPNWYISTSQAENMPV description INTERLEUKIN_1 Interleukin-1 signature. FeSAqfPnwYISTsqaenmpV source prosite : PS00253

Display surface Download Links