eF-site ID 8atc-D PDB Code 8atc Chain D click to enlarge Title COMPLEX OF N-PHOSPHONACETYL-L-ASPARTATE WITH ASPARTATE CARBAMOYLTRANSFERASE. X-RAY REFINEMENT, ANALYSIS OF CONFORMATIONAL CHANGES AND CATALYTIC AND ALLOSTERIC MECHANISMS Classification TRANSFERASE (CARBAMOYL-P,ASPARTATE) Compound ASPARTATE CARBAMOYLTRANSFERASE (R STATE), CATALYTIC CHAIN Source Escherichia coli (strain K12) (PYRI_ECOLI) Sequence D:  GVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQRITIGLN LPSGEMGRKDLIKIENTFLSEDQVDQLALYAPQATVNRID NYEVVGKSRPSLPERIDNVLVCPNSNCISHAEPVSSSFAV RKRANDIALKCKYCEKEFSHNVVLAN Description Functional site 1) chain D residue 109 type sequence C description Zinc binding site source : ZND 2) chain D residue 114 type sequence C description Zinc binding site source : ZND 3) chain D residue 138 type sequence C description Zinc binding site source : ZND 4) chain D residue 141 type sequence C description Zinc binding site source : ZND 5) chain D residue 109 type sequence C description BINDING SITE FOR RESIDUE ZN D 154 source : AC2 6) chain D residue 114 type sequence C description BINDING SITE FOR RESIDUE ZN D 154 source : AC2 7) chain D residue 138 type sequence C description BINDING SITE FOR RESIDUE ZN D 154 source : AC2 8) chain D residue 141 type sequence C description BINDING SITE FOR RESIDUE ZN D 154 source : AC2 9) chain D residue 109 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 10) chain D residue 114 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 11) chain D residue 138 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 12) chain D residue 141 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links