eF-site ID 6yvp-.AAA.BBB PDB Code 6yvp Chain AAA, BBB click to enlarge Title Human histidine triad nucleotide-binding protein 2 (hHINT2) complexed with dGMP and refined to 2.77 A Classification HYDROLASE Compound Histidine triad nucleotide-binding protein 2, mitochondrial Source (HINT2_HUMAN) Sequence AAA:  APTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLV IPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGY RLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG BBB:  APTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLV IPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGY RLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG Description Functional site 1) chain AAA residue 136-154 type prosite sequence NDGKLGAQSVYHLHIHVLG description HIT_1 HIT domain signature. NdgklGaQsVyHLHIHVLG source prosite : PS00892 2) chain AAA residue 149 type ACT_SITE sequence H description Tele-AMP-histidine intermediate => ECO:0000269|PubMed:16762638 source Swiss-Prot : SWS_FT_FI1 3) chain BBB residue 149 type ACT_SITE sequence H description Tele-AMP-histidine intermediate => ECO:0000269|PubMed:16762638 source Swiss-Prot : SWS_FT_FI1 4) chain AAA residue 63 type BINDING sequence S description BINDING => ECO:0000269|PubMed:23659632, ECO:0007744|PDB:4INI source Swiss-Prot : SWS_FT_FI2 5) chain BBB residue 149 type BINDING sequence H description BINDING => ECO:0000269|PubMed:23659632, ECO:0007744|PDB:4INI source Swiss-Prot : SWS_FT_FI2 6) chain AAA residue 80 type BINDING sequence D description BINDING => ECO:0000269|PubMed:23659632, ECO:0007744|PDB:4INI source Swiss-Prot : SWS_FT_FI2 7) chain AAA residue 136 type BINDING sequence N description BINDING => ECO:0000269|PubMed:23659632, ECO:0007744|PDB:4INI source Swiss-Prot : SWS_FT_FI2 8) chain AAA residue 142 type BINDING sequence A description BINDING => ECO:0000269|PubMed:23659632, ECO:0007744|PDB:4INI source Swiss-Prot : SWS_FT_FI2 9) chain AAA residue 149 type BINDING sequence H description BINDING => ECO:0000269|PubMed:23659632, ECO:0007744|PDB:4INI source Swiss-Prot : SWS_FT_FI2 10) chain BBB residue 63 type BINDING sequence S description BINDING => ECO:0000269|PubMed:23659632, ECO:0007744|PDB:4INI source Swiss-Prot : SWS_FT_FI2 11) chain BBB residue 80 type BINDING sequence D description BINDING => ECO:0000269|PubMed:23659632, ECO:0007744|PDB:4INI source Swiss-Prot : SWS_FT_FI2 12) chain BBB residue 136 type BINDING sequence N description BINDING => ECO:0000269|PubMed:23659632, ECO:0007744|PDB:4INI source Swiss-Prot : SWS_FT_FI2 13) chain BBB residue 142 type BINDING sequence A description BINDING => ECO:0000269|PubMed:23659632, ECO:0007744|PDB:4INI source Swiss-Prot : SWS_FT_FI2 14) chain AAA residue 119 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:Q9D0S9 source Swiss-Prot : SWS_FT_FI3 15) chain AAA residue 139 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:Q9D0S9 source Swiss-Prot : SWS_FT_FI3 16) chain BBB residue 119 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:Q9D0S9 source Swiss-Prot : SWS_FT_FI3 17) chain BBB residue 139 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:Q9D0S9 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links