eF-site ID 6w1p-E PDB Code 6w1p Chain E click to enlarge Title RT XFEL structure of the one-flash state of Photosystem II (1F, S2-rich) at 2.26 Angstrom resolution Classification PHOTOSYNTHESIS Compound Photosystem II protein D1 1 Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus (strain BP-1); Sequence E:  GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGL AYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQ LK Description Functional site 1) chain E residue 9 type sequence P description binding site for residue LHG A 413 source : AD4 2) chain E residue 10 type sequence F description binding site for residue LHG A 413 source : AD4 3) chain E residue 11 type sequence S description binding site for residue LHG A 413 source : AD4 4) chain E residue 13 type sequence I description binding site for residue HEC E 101 source : AK4 5) chain E residue 18 type sequence R description binding site for residue HEC E 101 source : AK4 6) chain E residue 19 type sequence Y description binding site for residue HEC E 101 source : AK4 7) chain E residue 23 type sequence H description binding site for residue HEC E 101 source : AK4 8) chain E residue 26 type sequence T description binding site for residue HEC E 101 source : AK4 9) chain E residue 30 type sequence L description binding site for residue HEC E 101 source : AK4 10) chain E residue 14-28 type prosite sequence ITSVRYWVIHSITIP description CYTOCHROME_B559 Cytochrome b559 subunits heme-binding site signature. ItSVRYwvIHSITIP source prosite : PS00537

Display surface Download Links