eF-site ID 6w1o-z PDB Code 6w1o Chain z click to enlarge Title RT XFEL structure of the dark-stable state of Photosystem II (0F, S1-rich) at 2.08 Angstrom resolution Classification PHOTOSYNTHESIS Compound Photosystem II protein D1 1 Source ORGANISM_SCIENTIFIC: Thermosynechococcus elongatus (strain BP-1); Sequence z:  MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLI FLGSGLWIALVLVVGVLNFFVV Description Functional site 1) chain z residue 20 type sequence V description binding site for residue CLA c 512 source : AS7 2) chain z residue 51 type sequence V description binding site for residue BCR c 515 source : AT1 3) chain z residue 55 type sequence G description binding site for residue BCR c 515 source : AT1 4) chain z residue 17 type sequence F description binding site for residue BCR k 101 source : AW2 5) chain z residue 16 type sequence S description binding site for residue BCR k 102 source : AW3 6) chain z residue 1-4 type TOPO_DOM sequence MTIL description Lumenal source Swiss-Prot : SWS_FT_FI1 7) chain z residue 1 type MOD_RES sequence M description N-formylmethionine => ECO:0000269|PubMed:19219048, ECO:0000269|PubMed:20558739 source Swiss-Prot : SWS_FT_FI5 8) chain z residue 5-25 type TRANSMEM sequence FQLALAALVILSFVMVIGVPV description Helical => ECO:0000269|PubMed:33846594, ECO:0007744|PDB:7NHQ source Swiss-Prot : SWS_FT_FI2 9) chain z residue 37-58 type TRANSMEM sequence KQLIFLGSGLWIALVLVVGVLN description Helical => ECO:0000269|PubMed:33846594, ECO:0007744|PDB:7NHQ source Swiss-Prot : SWS_FT_FI2 10) chain z residue 26-36 type TOPO_DOM sequence AYASPQDWDRS description Cytoplasmic => ECO:0000269|PubMed:33846594, ECO:0007744|PDB:7NHQ source Swiss-Prot : SWS_FT_FI3 11) chain z residue 59-62 type TOPO_DOM sequence FFVV description Lumenal => ECO:0000269|PubMed:33846594, ECO:0007744|PDB:7NHQ source Swiss-Prot : SWS_FT_FI4

Display surface Download Links