eF-site ID 6ve7-m PDB Code 6ve7 Chain m click to enlarge Title The inner junction complex of Chlamydomonas reinhardtii doublet microtubule Classification STRUCTURAL PROTEIN Compound Flagellar associated protein Source ORGANISM_SCIENTIFIC: Chlamydomonas reinhardtii; Sequence m:  MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPSDK TIGGGDDAFNTFFSETGAGKHVPRCIFLDLEPTVVDEVRT GTYRQLFHPEQLISGKEDAANNFARGHYTIGKEIVDLALD RIRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVD YGKKSKLGFTVYPSPQVSTAVVEPYNSVLSTHSLLEHTDV AVMLDNEAIYDICRRSLDIERPTYTNLNRLIAQVISSLTA SLRFDGALNVDITEFQTNLVPYPRIHFMLSSYAPIISAEK AYHEQLSVAEITNAAFEPASMMVKCDPRHGKYMACCLMYR GDVVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPP TVVPGGDLAKVQRAVCMISNSTAIGEIFSRLDHKFDLMYA KRAFVHWYVGEGMEEGEFSEAREDLAALEKDFEEVG Description (1)  Flagellar associated protein, FAP52, Tubulin alpha, Protein Flattop homolog, Tubulin beta, FAP276, Cilia- and flagella-associated protein 20, PACRG Functional site 1) chain m residue 10 type sequence G description binding site for residue GTP m 501 source : AH6 2) chain m residue 11 type sequence Q description binding site for residue GTP m 501 source : AH6 3) chain m residue 12 type sequence A description binding site for residue GTP m 501 source : AH6 4) chain m residue 15 type sequence Q description binding site for residue GTP m 501 source : AH6 5) chain m residue 71 type sequence E description binding site for residue GTP m 501 source : AH6 6) chain m residue 98 type sequence D description binding site for residue GTP m 501 source : AH6 7) chain m residue 99 type sequence A description binding site for residue GTP m 501 source : AH6 8) chain m residue 100 type sequence A description binding site for residue GTP m 501 source : AH6 9) chain m residue 101 type sequence N description binding site for residue GTP m 501 source : AH6 10) chain m residue 143 type sequence G description binding site for residue GTP m 501 source : AH6 11) chain m residue 144 type sequence G description binding site for residue GTP m 501 source : AH6 12) chain m residue 145 type sequence T description binding site for residue GTP m 501 source : AH6 13) chain m residue 146 type sequence G description binding site for residue GTP m 501 source : AH6 14) chain m residue 179 type sequence T description binding site for residue GTP m 501 source : AH6 15) chain m residue 206 type sequence N description binding site for residue GTP m 501 source : AH6 16) chain m residue 224 type sequence Y description binding site for residue GTP m 501 source : AH6 17) chain m residue 228 type sequence N description binding site for residue GTP m 501 source : AH6 18) chain m residue 71 type sequence E description binding site for residue MG m 502 source : AH7 19) chain m residue 40 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:2441392 source Swiss-Prot : SWS_FT_FI4 20) chain m residue 11 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 21) chain m residue 71 type BINDING sequence E description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 22) chain m residue 144 type BINDING sequence G description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 23) chain m residue 145 type BINDING sequence T description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 24) chain m residue 179 type BINDING sequence T description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 25) chain m residue 206 type BINDING sequence N description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 26) chain m residue 228 type BINDING sequence N description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links