eF-site ID 6ve7-M PDB Code 6ve7 Chain M click to enlarge Title The inner junction complex of Chlamydomonas reinhardtii doublet microtubule Classification STRUCTURAL PROTEIN Compound Flagellar associated protein Source ORGANISM_SCIENTIFIC: Chlamydomonas reinhardtii; Sequence M:  MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPDDA FNTFFSETGAGKHVPRCIFLDLEPTVVDEVRTGTYRQLFH PEQLISGKEDAANNFARGHYTIGKEIVDLALDRIRKLADN CTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLG FTVYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVMLDNEA IYDICRRSLDIERPTYTNLNRLIAQVISSLTASLRFDGAL NVDITEFQTNLVPYPRIHFMLSSYAPIISAEKAYHEQLSV AEITNAAFEPASMMVKCDPRHGKYMACCLMYRGDVVPKDV NASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDL AKVQRAVCMISNSTAIGEIFSRLDHKFDLMYAKRAFVHWY VGEGMEEGEFSEAREDLAALEKDFEEVG Description (1)  Flagellar associated protein, FAP52, Tubulin alpha, Protein Flattop homolog, Tubulin beta, FAP276, Cilia- and flagella-associated protein 20, PACRG Functional site 1) chain M residue 10 type sequence G description binding site for residue GTP M 501 source : AD6 2) chain M residue 11 type sequence Q description binding site for residue GTP M 501 source : AD6 3) chain M residue 12 type sequence A description binding site for residue GTP M 501 source : AD6 4) chain M residue 15 type sequence Q description binding site for residue GTP M 501 source : AD6 5) chain M residue 71 type sequence E description binding site for residue GTP M 501 source : AD6 6) chain M residue 100 type sequence A description binding site for residue GTP M 501 source : AD6 7) chain M residue 101 type sequence N description binding site for residue GTP M 501 source : AD6 8) chain M residue 143 type sequence G description binding site for residue GTP M 501 source : AD6 9) chain M residue 144 type sequence G description binding site for residue GTP M 501 source : AD6 10) chain M residue 145 type sequence T description binding site for residue GTP M 501 source : AD6 11) chain M residue 146 type sequence G description binding site for residue GTP M 501 source : AD6 12) chain M residue 206 type sequence N description binding site for residue GTP M 501 source : AD6 13) chain M residue 224 type sequence Y description binding site for residue GTP M 501 source : AD6 14) chain M residue 228 type sequence N description binding site for residue GTP M 501 source : AD6 15) chain M residue 71 type sequence E description binding site for residue MG M 502 source : AD7 16) chain M residue 11 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 17) chain M residue 71 type BINDING sequence E description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 18) chain M residue 144 type BINDING sequence G description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 19) chain M residue 145 type BINDING sequence T description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 20) chain M residue 179 type BINDING sequence T description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 21) chain M residue 206 type BINDING sequence N description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 22) chain M residue 228 type BINDING sequence N description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links