eF-site ID 6ve7-F PDB Code 6ve7 Chain F click to enlarge Title The inner junction complex of Chlamydomonas reinhardtii doublet microtubule Classification STRUCTURAL PROTEIN Compound Flagellar associated protein Source ORGANISM_SCIENTIFIC: Chlamydomonas reinhardtii; Sequence F:  MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPDDA FNTFFSETGAGKHVPRCIFLDLEPTVVDEVRTGTYRQLFH PEQLISGKEDAANNFARGHYTIGKEIVDLALDRIRKLADN CTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLG FTVYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVMLDNEA IYDICRRSLDIERPTYTNLNRLIAQVISSLTASLRFDGAL NVDITEFQTNLVPYPRIHFMLSSYAPIISAEKAYHEQLSV AEITNAAFEPASMMVKCDPRHGKYMACCLMYRGDVVPKDV NASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDL AKVQRAVCMISNSTAIGEIFSRLDHKFDLMYAKRAFVHWY VGEGMEEGEFSEAREDLAALEKDFEEVG Description (1)  Flagellar associated protein, FAP52, Tubulin alpha, Protein Flattop homolog, Tubulin beta, FAP276, Cilia- and flagella-associated protein 20, PACRG Functional site 1) chain F residue 11 type sequence Q description binding site for residue GTP F 501 source : AC5 2) chain F residue 12 type sequence A description binding site for residue GTP F 501 source : AC5 3) chain F residue 15 type sequence Q description binding site for residue GTP F 501 source : AC5 4) chain F residue 71 type sequence E description binding site for residue GTP F 501 source : AC5 5) chain F residue 99 type sequence A description binding site for residue GTP F 501 source : AC5 6) chain F residue 100 type sequence A description binding site for residue GTP F 501 source : AC5 7) chain F residue 101 type sequence N description binding site for residue GTP F 501 source : AC5 8) chain F residue 143 type sequence G description binding site for residue GTP F 501 source : AC5 9) chain F residue 144 type sequence G description binding site for residue GTP F 501 source : AC5 10) chain F residue 145 type sequence T description binding site for residue GTP F 501 source : AC5 11) chain F residue 146 type sequence G description binding site for residue GTP F 501 source : AC5 12) chain F residue 179 type sequence T description binding site for residue GTP F 501 source : AC5 13) chain F residue 206 type sequence N description binding site for residue GTP F 501 source : AC5 14) chain F residue 224 type sequence Y description binding site for residue GTP F 501 source : AC5 15) chain F residue 227 type sequence L description binding site for residue GTP F 501 source : AC5 16) chain F residue 228 type sequence N description binding site for residue GTP F 501 source : AC5 17) chain F residue 71 type sequence E description binding site for residue MG F 502 source : AC6 18) chain F residue 248 type sequence L description binding site for residue GDP 8 501 source : AL4

Display surface Download Links