eF-site ID 6ve7-6 PDB Code 6ve7 Chain 6 click to enlarge Title The inner junction complex of Chlamydomonas reinhardtii doublet microtubule Classification STRUCTURAL PROTEIN Compound Flagellar associated protein Source ORGANISM_SCIENTIFIC: Chlamydomonas reinhardtii; Sequence 6:  MREVISIHIGQAGIQVGNACWELYCLEHGIQPDGQMPDDA FNTFFSETGAGKHVPRCIFLDLEPTVVDEVRTGTYRQLFH PEQLISGKEDAANNFARGHYTIGKEIVDLALDRIRKLADN CTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLG FTVYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVMLDNEA IYDICRRSLDIERPTYTNLNRLIAQVISSLTASLRFDGAL NVDITEFQTNLVPYPRIHFMLSSYAPIISAEKAYHEQLSV AEITNAAFEPASMMVKCDPRHGKYMACCLMYRGDVVPKDV NASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDL AKVQRAVCMISNSTAIGEIFSRLDHKFDLMYAKRAFVHWY VGEGMEEGEFSEAREDLAALEKDFEEVG Description (1)  Flagellar associated protein, FAP52, Tubulin alpha, Protein Flattop homolog, Tubulin beta, FAP276, Cilia- and flagella-associated protein 20, PACRG Functional site 1) chain 6 residue 10 type sequence G description binding site for residue GTP 6 501 source : AK9 2) chain 6 residue 11 type sequence Q description binding site for residue GTP 6 501 source : AK9 3) chain 6 residue 12 type sequence A description binding site for residue GTP 6 501 source : AK9 4) chain 6 residue 15 type sequence Q description binding site for residue GTP 6 501 source : AK9 5) chain 6 residue 71 type sequence E description binding site for residue GTP 6 501 source : AK9 6) chain 6 residue 98 type sequence D description binding site for residue GTP 6 501 source : AK9 7) chain 6 residue 99 type sequence A description binding site for residue GTP 6 501 source : AK9 8) chain 6 residue 100 type sequence A description binding site for residue GTP 6 501 source : AK9 9) chain 6 residue 101 type sequence N description binding site for residue GTP 6 501 source : AK9 10) chain 6 residue 143 type sequence G description binding site for residue GTP 6 501 source : AK9 11) chain 6 residue 144 type sequence G description binding site for residue GTP 6 501 source : AK9 12) chain 6 residue 145 type sequence T description binding site for residue GTP 6 501 source : AK9 13) chain 6 residue 146 type sequence G description binding site for residue GTP 6 501 source : AK9 14) chain 6 residue 179 type sequence T description binding site for residue GTP 6 501 source : AK9 15) chain 6 residue 206 type sequence N description binding site for residue GTP 6 501 source : AK9 16) chain 6 residue 224 type sequence Y description binding site for residue GTP 6 501 source : AK9 17) chain 6 residue 227 type sequence L description binding site for residue GTP 6 501 source : AK9 18) chain 6 residue 228 type sequence N description binding site for residue GTP 6 501 source : AK9 19) chain 6 residue 71 type sequence E description binding site for residue MG 6 502 source : AL1 20) chain 6 residue 11 type BINDING sequence Q description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 21) chain 6 residue 71 type BINDING sequence E description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 22) chain 6 residue 144 type BINDING sequence G description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 23) chain 6 residue 145 type BINDING sequence T description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 24) chain 6 residue 179 type BINDING sequence T description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 25) chain 6 residue 206 type BINDING sequence N description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2 26) chain 6 residue 228 type BINDING sequence N description BINDING => ECO:0000250|UniProtKB:P68363 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links