eF-site ID 6twz-C PDB Code 6twz Chain C click to enlarge Title 14-3-3 sigma complexed with a phosphorylated 16E6 peptide Classification PEPTIDE BINDING PROTEIN Compound 14-3-3 protein sigma Source (6TWZ) Sequence C:  PHMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSC EERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGEKGPE VREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFY LKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISAA AMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDE AMADLHTLSEDSYKDSTLIMQLLRDNLTLWT Description Functional site 1) chain C residue 93 type sequence Q description binding site for residue TAR C 301 source : AC3 2) chain C residue 97 type sequence D description binding site for residue TAR C 301 source : AC3 3) chain C residue 131 type sequence L description binding site for residue TAR C 301 source : AC3 4) chain C residue 139 type sequence D description binding site for residue TAR C 301 source : AC3 5) chain C residue 56 type sequence R description binding site for Di-peptide GLU F 155 and TPO F 156 source : AD1 6) chain C residue 129 type sequence R description binding site for Di-peptide GLU F 155 and TPO F 156 source : AD1 7) chain C residue 130 type sequence Y description binding site for Di-peptide GLU F 155 and TPO F 156 source : AD1 8) chain C residue 175 type sequence N description binding site for Di-peptide GLU F 155 and TPO F 156 source : AD1 9) chain C residue 178 type sequence V description binding site for Di-peptide GLU F 155 and TPO F 156 source : AD1 10) chain C residue 222 type sequence L description binding site for Di-peptide GLU F 155 and TPO F 156 source : AD1 11) chain C residue 226 type sequence N description binding site for Di-peptide GLU F 155 and TPO F 156 source : AD1 12) chain C residue 56 type sequence R description binding site for Di-peptide TPO F 156 and GLN F 157 source : AD2 13) chain C residue 122 type sequence K description binding site for Di-peptide TPO F 156 and GLN F 157 source : AD2 14) chain C residue 129 type sequence R description binding site for Di-peptide TPO F 156 and GLN F 157 source : AD2 15) chain C residue 130 type sequence Y description binding site for Di-peptide TPO F 156 and GLN F 157 source : AD2 16) chain C residue 175 type sequence N description binding site for Di-peptide TPO F 156 and GLN F 157 source : AD2 17) chain C residue 178 type sequence V description binding site for Di-peptide TPO F 156 and GLN F 157 source : AD2 18) chain C residue 218 type sequence L description binding site for Di-peptide TPO F 156 and GLN F 157 source : AD2 19) chain C residue 56 type SITE sequence R description Interaction with phosphoserine on interacting protein source Swiss-Prot : SWS_FT_FI1 20) chain C residue 129 type SITE sequence R description Interaction with phosphoserine on interacting protein source Swiss-Prot : SWS_FT_FI1 21) chain C residue 5 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:20068231 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links