eF-site ID 6spb-K
PDB Code 6spb
Chain K

click to enlarge
Title Pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in uL6
Classification RIBOSOME
Compound 23S ribosomal RNA
Source ORGANISM_SCIENTIFIC: Pseudomonas aeruginosa;
Sequence K:  MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIK
VTVKEAIPRGKVKKGQVMTAVVVRTKHGVRRTDGSIIRFD
GNAAVLLNNKQEPIGTRIFGPVTRELRTEKFMKIVSLAPE
Description (1)  50S ribosomal protein L2, 50S ribosomal protein L3, 50S ribosomal protein L4, 50S ribosomal protein L5, 50S ribosomal protein L6, 50S ribosomal protein L9, 50S ribosomal protein L11, 50S ribosomal protein L13, 50S ribosomal protein L14, 50S ribosomal protein L15, 50S ribosomal protein L16, 50S ribosomal protein L17, 50S ribosomal protein L18, 50S ribosomal protein L19, 50S ribosomal protein L20, 50S ribosomal protein L21, 50S ribosomal protein L22, 50S ribosomal protein L23, 50S ribosomal protein L24, 50S ribosomal protein L25, 50S ribosomal protein L27, 50S ribosomal protein L28, 50S ribosomal protein L29, 50S ribosomal protein L30, 50S ribosomal protein L31, 50S ribosomal protein L32, 50S ribosomal protein L33, 50S ribosomal protein L34, 50S ribosomal protein L35, 50S ribosomal protein L36/RNA Complex


Functional site

1) chain K
residue 60-86
type prosite
sequence AVVVRTKHGVRRTDGSIIRFDGNAAVL
description RIBOSOMAL_L14 Ribosomal protein L14 signature. AVVVrtkhgvrrt.DGsiirFdgNaaVL
source prosite : PS00049


Display surface

Download
Links