eF-site ID 6se6-H
PDB Code 6se6
Chain H

click to enlarge
Title Class2 : CENP-A nucleosome in complex with CENP-C central region
Classification NUCLEAR PROTEIN
Compound Histone H3-like centromeric protein A
Source (CENPC_HUMAN)
Sequence H:  ESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIA
GEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEG
TKAVTKYTSS
Description (1)  Histone H3-like centromeric protein A, Histone H4, Histone H2A type 2-A, Histone H2B type 1-C/E/F/G/I, Centromere protein C/DNA Complex


Functional site

1) chain H
residue 120
type CROSSLNK
sequence K
description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:16307923, ECO:0000269|PubMed:16627869, ECO:0000269|PubMed:16713563, ECO:0000269|PubMed:22121020
source Swiss-Prot : SWS_FT_FI18

2) chain H
residue 112
type CARBOHYD
sequence S
description O-linked (GlcNAc) serine => ECO:0000269|PubMed:22121020
source Swiss-Prot : SWS_FT_FI16

3) chain H
residue 43
type CROSSLNK
sequence K
description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733
source Swiss-Prot : SWS_FT_FI3

4) chain H
residue 85
type CROSSLNK
sequence K
description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733
source Swiss-Prot : SWS_FT_FI3

5) chain H
residue 116
type MOD_RES
sequence K
description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435
source Swiss-Prot : SWS_FT_FI8

6) chain H
residue 120
type MOD_RES
sequence K
description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435
source Swiss-Prot : SWS_FT_FI8

7) chain H
residue 35
type MOD_RES
sequence E
description PolyADP-ribosyl glutamic acid => ECO:0000250|UniProtKB:Q64475
source Swiss-Prot : SWS_FT_FI9

8) chain H
residue 36
type MOD_RES
sequence S
description Phosphoserine; by AMPK => ECO:0000250|UniProtKB:Q6ZWY9
source Swiss-Prot : SWS_FT_FI10

9) chain H
residue 46
type MOD_RES
sequence K
description N6-methyllysine; alternate => ECO:0000269|PubMed:16627869
source Swiss-Prot : SWS_FT_FI11

10) chain H
residue 108
type MOD_RES
sequence K
description N6-methyllysine; alternate => ECO:0000269|PubMed:16627869
source Swiss-Prot : SWS_FT_FI11

11) chain H
residue 57
type MOD_RES
sequence K
description N6-(2-hydroxyisobutyryl)lysine; alternate => ECO:0000269|PubMed:24681537
source Swiss-Prot : SWS_FT_FI12

12) chain H
residue 79
type MOD_RES
sequence R
description Dimethylated arginine => ECO:0000250|UniProtKB:Q96A08
source Swiss-Prot : SWS_FT_FI13

13) chain H
residue 86
type MOD_RES
sequence R
description Omega-N-methylarginine => ECO:0000250|UniProtKB:Q96A08
source Swiss-Prot : SWS_FT_FI14

14) chain H
residue 92
type MOD_RES
sequence R
description Omega-N-methylarginine => ECO:0000250|UniProtKB:Q96A08
source Swiss-Prot : SWS_FT_FI14

15) chain H
residue 115
type MOD_RES
sequence T
description Phosphothreonine => ECO:0000250|UniProtKB:Q00729
source Swiss-Prot : SWS_FT_FI15


Display surface

Download
Links