|
click to enlarge |
||||||||||||||||||||||
|
|||||||||||||||||||||||
Functional site
| 1) | chain | A |
| residue | 699 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1101 | |
| source | : AC1 | |
| 2) | chain | A |
| residue | 702 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1101 | |
| source | : AC1 | |
| 3) | chain | A |
| residue | 722 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1101 | |
| source | : AC1 | |
| 4) | chain | A |
| residue | 725 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1101 | |
| source | : AC1 | |
| 5) | chain | A |
| residue | 717 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1102 | |
| source | : AC2 | |
| 6) | chain | A |
| residue | 719 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1102 | |
| source | : AC2 | |
| 7) | chain | A |
| residue | 744 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1102 | |
| source | : AC2 | |
| 8) | chain | A |
| residue | 747 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1102 | |
| source | : AC2 | |
| 9) | chain | A |
| residue | 799 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1103 | |
| source | : AC3 | |
| 10) | chain | A |
| residue | 802 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1103 | |
| source | : AC3 | |
| 11) | chain | A |
| residue | 817 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1103 | |
| source | : AC3 | |
| 12) | chain | A |
| residue | 820 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1103 | |
| source | : AC3 | |
| 13) | chain | A |
| residue | 825 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1104 | |
| source | : AC4 | |
| 14) | chain | A |
| residue | 828 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1104 | |
| source | : AC4 | |
| 15) | chain | A |
| residue | 836 | |
| type | ||
| sequence | H | |
| description | binding site for residue ZN A 1104 | |
| source | : AC4 | |
| 16) | chain | A |
| residue | 841 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1104 | |
| source | : AC4 | |
| 17) | chain | A |
| residue | 871 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1105 | |
| source | : AC5 | |
| 18) | chain | A |
| residue | 874 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1105 | |
| source | : AC5 | |
| 19) | chain | A |
| residue | 890 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1105 | |
| source | : AC5 | |
| 20) | chain | A |
| residue | 893 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1105 | |
| source | : AC5 | |
| 21) | chain | A |
| residue | 898 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1106 | |
| source | : AC6 | |
| 22) | chain | A |
| residue | 901 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1106 | |
| source | : AC6 | |
| 23) | chain | A |
| residue | 926 | |
| type | ||
| sequence | H | |
| description | binding site for residue ZN A 1106 | |
| source | : AC6 | |
| 24) | chain | A |
| residue | 930 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1106 | |
| source | : AC6 | |
| 25) | chain | A |
| residue | 911 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1107 | |
| source | : AC7 | |
| 26) | chain | A |
| residue | 916 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1107 | |
| source | : AC7 | |
| 27) | chain | A |
| residue | 923 | |
| type | ||
| sequence | H | |
| description | binding site for residue ZN A 1107 | |
| source | : AC7 | |
| 28) | chain | A |
| residue | 925 | |
| type | ||
| sequence | H | |
| description | binding site for residue ZN A 1107 | |
| source | : AC7 | |
| 29) | chain | A |
| residue | 969 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1108 | |
| source | : AC8 | |
| 30) | chain | A |
| residue | 986 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1108 | |
| source | : AC8 | |
| 31) | chain | A |
| residue | 998 | |
| type | ||
| sequence | C | |
| description | binding site for residue ZN A 1108 | |
| source | : AC8 | |
| 32) | chain | A |
| residue | 1001 | |
| type | ||
| sequence | H | |
| description | binding site for residue ZN A 1108 | |
| source | : AC8 | |
| 33) | chain | A |
| residue | 903 | |
| type | ||
| sequence | N | |
| description | binding site for residue SO4 A 1109 | |
| source | : AC9 | |
| 34) | chain | A |
| residue | 927 | |
| type | ||
| sequence | P | |
| description | binding site for residue SO4 A 1109 | |
| source | : AC9 | |
| 35) | chain | A |
| residue | 1064 | |
| type | ||
| sequence | G | |
| description | binding site for residue SO4 A 1109 | |
| source | : AC9 | |
| 36) | chain | A |
| residue | 1065 | |
| type | ||
| sequence | Q | |
| description | binding site for residue SO4 A 1109 | |
| source | : AC9 | |
| 37) | chain | A |
| residue | 884 | |
| type | ||
| sequence | G | |
| description | binding site for residue SO4 A 1110 | |
| source | : AD1 | |
| 38) | chain | A |
| residue | 885 | |
| type | ||
| sequence | C | |
| description | binding site for residue SO4 A 1110 | |
| source | : AD1 | |
| 39) | chain | A |
| residue | 886 | |
| type | ||
| sequence | M | |
| description | binding site for residue SO4 A 1110 | |
| source | : AD1 | |
| 40) | chain | A |
| residue | 932 | |
| type | ||
| sequence | F | |
| description | binding site for residue SO4 A 1110 | |
| source | : AD1 | |
| 41) | chain | A |
| residue | 935 | |
| type | ||
| sequence | R | |
| description | binding site for residue SO4 A 1110 | |
| source | : AD1 | |
| 42) | chain | A |
| residue | 1032 | |
| type | ||
| sequence | R | |
| description | binding site for residue SO4 A 1111 | |
| source | : AD2 | |
| 43) | chain | A |
| residue | 798 | |
| type | ||
| sequence | W | |
| description | binding site for residue CL A 1112 | |
| source | : AD3 | |
| 44) | chain | A |
| residue | 829 | |
| type | ||
| sequence | K | |
| description | binding site for residue CL A 1112 | |
| source | : AD3 | |
| 45) | chain | A |
| residue | 900 | |
| type | ||
| sequence | G | |
| description | binding site for residue CL A 1113 | |
| source | : AD4 | |
| 46) | chain | A |
| residue | 930 | |
| type | ||
| sequence | C | |
| description | binding site for residue CL A 1113 | |
| source | : AD4 | |
| 47) | chain | A |
| residue | 931 | |
| type | ||
| sequence | L | |
| description | binding site for residue CL A 1113 | |
| source | : AD4 | |
| 48) | chain | A |
| residue | 1011 | |
| type | ||
| sequence | N | |
| description | binding site for residue CL A 1113 | |
| source | : AD4 | |
| 49) | chain | A |
| residue | 893-902 | |
| type | prosite | |
| sequence | CRHQFCSGCY | |
| description | ZF_RING_1 Zinc finger RING-type signature. CrHqFCsgCY | |
| source | prosite : PS00518 | |
| 50) | chain | A |
| residue | 799 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI7 | |
| 51) | chain | A |
| residue | 802 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI7 | |
| 52) | chain | A |
| residue | 817 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI7 | |
| 53) | chain | A |
| residue | 820 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI7 | |
| 54) | chain | A |
| residue | 825 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI7 | |
| 55) | chain | A |
| residue | 828 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI7 | |
| 56) | chain | A |
| residue | 836 | |
| type | BINDING | |
| sequence | H | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI7 | |
| 57) | chain | A |
| residue | 841 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI7 | |
| 58) | chain | A |
| residue | 871 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI7 | |
| 59) | chain | A |
| residue | 874 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI7 | |
| 60) | chain | A |
| residue | 890 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI7 | |
| 61) | chain | A |
| residue | 893 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI7 | |
| 62) | chain | A |
| residue | 898 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI7 | |
| 63) | chain | A |
| residue | 901 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI7 | |
| 64) | chain | A |
| residue | 916 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI7 | |
| 65) | chain | A |
| residue | 925 | |
| type | BINDING | |
| sequence | H | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI7 | |
| 66) | chain | A |
| residue | 735 | |
| type | CROSSLNK | |
| sequence | K | |
| description | (Microbial infection) Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:27572974 | |
| source | Swiss-Prot : SWS_FT_FI8 | |
| 67) | chain | A |
| residue | 783 | |
| type | CROSSLNK | |
| sequence | K | |
| description | (Microbial infection) Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:27572974 | |
| source | Swiss-Prot : SWS_FT_FI8 | |
| 68) | chain | A |
| residue | 875 | |
| type | CROSSLNK | |
| sequence | K | |
| description | (Microbial infection) Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:27572974 | |
| source | Swiss-Prot : SWS_FT_FI8 | |
| 69) | chain | A |
| residue | 699-749 | |
| type | ZN_FING | |
| sequence |
CAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKH ITDMVCPACGR |
|
| description | RING-type 1 => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI1 | |
| 70) | chain | A |
| residue | 779-841 | |
| type | ZN_FING | |
| sequence |
ALFHKKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCP QCHQTFCVRCKRQWEEQHRGRSC |
|
| description | IBR-type => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI2 | |
| 71) | chain | A |
| residue | 871-901 | |
| type | ZN_FING | |
| sequence | CPKCKFSYALARGGCMHFHCTQCRHQFCSGC | |
| description | RING-type 2; atypical => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI3 | |
| 72) | chain | A |
| residue | 885 | |
| type | ACT_SITE | |
| sequence | C | |
| description | ACT_SITE => ECO:0000255|PROSITE-ProRule:PRU01221 | |
| source | Swiss-Prot : SWS_FT_FI4 | |
| 73) | chain | A |
| residue | 699 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221, ECO:0000269|PubMed:35294289, ECO:0007744|PDB:7V8F, ECO:0007744|PDB:7V8G | |
| source | Swiss-Prot : SWS_FT_FI5 | |
| 74) | chain | A |
| residue | 702 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221, ECO:0000269|PubMed:35294289, ECO:0007744|PDB:7V8F, ECO:0007744|PDB:7V8G | |
| source | Swiss-Prot : SWS_FT_FI5 | |
| 75) | chain | A |
| residue | 722 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221, ECO:0000269|PubMed:35294289, ECO:0007744|PDB:7V8F, ECO:0007744|PDB:7V8G | |
| source | Swiss-Prot : SWS_FT_FI5 | |
| 76) | chain | A |
| residue | 725 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000255|PROSITE-ProRule:PRU01221, ECO:0000269|PubMed:35294289, ECO:0007744|PDB:7V8F, ECO:0007744|PDB:7V8G | |
| source | Swiss-Prot : SWS_FT_FI5 | |
| 77) | chain | A |
| residue | 719 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000269|PubMed:35294289, ECO:0007744|PDB:7V8F, ECO:0007744|PDB:7V8G | |
| source | Swiss-Prot : SWS_FT_FI6 | |
| 78) | chain | A |
| residue | 717 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000269|PubMed:35294289, ECO:0007744|PDB:7V8F, ECO:0007744|PDB:7V8G | |
| source | Swiss-Prot : SWS_FT_FI6 | |
| 79) | chain | A |
| residue | 744 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000269|PubMed:35294289, ECO:0007744|PDB:7V8F, ECO:0007744|PDB:7V8G | |
| source | Swiss-Prot : SWS_FT_FI6 | |
| 80) | chain | A |
| residue | 747 | |
| type | BINDING | |
| sequence | C | |
| description | BINDING => ECO:0000269|PubMed:35294289, ECO:0007744|PDB:7V8F, ECO:0007744|PDB:7V8G | |
| source | Swiss-Prot : SWS_FT_FI6 | |