eF-site ID 6s0o-E
PDB Code 6s0o
Chain E

click to enlarge
Title Crystal Structure of Two-Domain Laccase from Streptomyces griseoflavus produced at 0.25 mM copper sulfate in growth medium
Classification OXIDOREDUCTASE
Compound Two-domain laccase
Source (A0A0M4FJ81_9ACTN)
Sequence E:  AGAAPAGGEVRRVTMYAERLAGGQMGYGLEKGKASIPGPL
IELNEGDTLHVEFENTMDVPVSLHVHGLDYEISSDGTKQN
KSHVEPGGTRTYTWRTHEPGRRADGTWRAGSAGYWHYHDH
VVGTEHGTGGIRNGLYGPVIVRRKGDVLPDATHTIVFNDM
TINNRPAHTGPNFEATVGDRVEIVMITHGEYYHTFHMHGH
RWADNRTGMLTGPDDPSQVIDNKICGPADSFGFQIIAGEG
VGAGAWMYHCHVQSHSDMGMVGLFLVKKPDGTIPGYDP
Description (1)  Two-domain laccase (E.C.1.10.3.2)


Functional site

1) chain E
residue 290
type
ligand
sequence H
description binding site for residue CU D 404
source : AE4

2) chain E
residue 232
type
ligand
sequence H
description binding site for residue CU E 401
source : AE7

3) chain E
residue 289
type
ligand
sequence C
description binding site for residue CU E 401
source : AE7

4) chain E
residue 294
type
ligand
sequence H
description binding site for residue CU E 401
source : AE7

5) chain E
residue 299
type
ligand
sequence M
description binding site for residue CU E 401
source : AE7

6) chain E
residue 237
type
ligand
sequence H
description binding site for residue CU E 402
source : AE8

7) chain E
residue 288
type
ligand
sequence H
description binding site for residue CU E 402
source : AE8

8) chain E
residue 235
type
ligand
sequence H
description binding site for residue CU E 403
source : AE9

9) chain E
residue 237
type
ligand
sequence H
description binding site for residue CU E 403
source : AE9

10) chain E
residue 103
type
ligand
sequence H
description binding site for residue CU E 404
source : AF1

11) chain E
residue 105
type
ligand
sequence H
description binding site for residue CU E 404
source : AF1

12) chain E
residue 157
type
ligand
sequence H
description binding site for residue CU E 404
source : AF1

13) chain E
residue 103
type
ligand
sequence H
description binding site for residue CU E 405
source : AF2

14) chain E
residue 105
type
ligand
sequence H
description binding site for residue CU E 405
source : AF2

15) chain E
residue 132
type
ligand
sequence T
description binding site for residue SO4 E 406
source : AF3

16) chain E
residue 134
type
ligand
sequence R
description binding site for residue SO4 E 406
source : AF3

17) chain E
residue 159
type
ligand
sequence H
description binding site for residue CU F 403
source : AF6


Display surface

Download
Links