eF-site ID 6rzz-w PDB Code 6rzz Chain w click to enlarge Title Cryo-EM structures of Lsg1-TAP pre-60S ribosomal particles Classification RIBOSOME Compound 25S ribosomal RNA Source ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae; ORGANISM_COMMON: Baker's yeast; Sequence w:  TLLCCNCGTPIDGSTGLVMCYDCIKLTVDITQGIPREANI SFCRNCERFLQPPGQWIRAELESRELLAICLRRLKGLTKV RLVDASFIWTEPHSRRIRIKLTVQGEAMTNTIIQQTFEVE YIVIAMQCPDCARSYTTNTWRATVQIRQKVPHKRTFLFLE QLILKHNAHVDTISISEAKDGLDFFYAQKNHAVKMIDFLN AVVPIKHKKSEELISQDTHTGASTYKFSYSVEIVPICKDD LVVLPKKLAKSMGNISQFVLCSKISNTVQFMDPTTLQTAD LSPSVYWRAPFNALADVTQLVEFIVLDVDSTGISRGNRVL ADITVARTSDLGVNDQVYYVRSHLGGICHAGDSVMGYFIA NSNYNSDLFDGLNIDYVPDVVLVKKLYQR Description Functional site 1) chain w residue 58 type sequence C description binding site for residue ZN w 601 source : AC9 2) chain w residue 61 type sequence C description binding site for residue ZN w 601 source : AC9 3) chain w residue 143 type sequence C description binding site for residue ZN w 601 source : AC9 4) chain w residue 146 type sequence C description binding site for residue ZN w 601 source : AC9 5) chain w residue 19 type sequence C description binding site for residue ZN w 602 source : AD1 6) chain w residue 22 type sequence C description binding site for residue ZN w 602 source : AD1 7) chain w residue 35 type sequence C description binding site for residue ZN w 602 source : AD1 8) chain w residue 38 type sequence C description binding site for residue ZN w 602 source : AD1

Display surface Download Links