eF-site ID 6rzz-u PDB Code 6rzz Chain u click to enlarge Title Cryo-EM structures of Lsg1-TAP pre-60S ribosomal particles Classification RIBOSOME Compound 25S ribosomal RNA Source ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae; ORGANISM_COMMON: Baker's yeast; Sequence u:  AERVMQEKLRNRVDIPLEQCLFCEHNKHFKDVEENLEHMF RTHGFYIPEQKYLVDKIGLVKYMSEKIGLGNICIVCNYQG RTLTAVRQHMLAKRHCKIPYESEDERLEISEFYDFTSNDG IELHLPTGIKVGHRSLQRYYKQDLKPEVILTEGQGTLVAA ETRSFLPAFDKKGVQTQQRVWQTERFDKKRLDKRSAKFVN NQPHYRDQLLQ Description (1)  60S ribosomal protein L2-A, 60S ribosomal protein L3, 60S ribosomal protein L4-A, 60S ribosomal protein L11-A, 60S ribosomal protein L9-A, 60S ribosomal protein L6-A, 60S ribosomal protein L8-A, 60S ribosomal protein L16-B, 60S ribosomal protein L13-A, 60S ribosomal protein L23-A, 60S ribosomal protein L14-A, 60S ribosomal protein L28, 60S ribosomal protein L15-A, 60S ribosomal protein L5, 60S ribosomal protein L18-A, 60S ribosomal protein L19-A, 60S ribosomal protein L20-A, 60S ribosomal protein L21-A, 60S ribosomal protein L17-A, 60S ribosomal protein L22-A, 60S ribosomal protein L25, 60S ribosomal protein L26-A, 60S ribosomal protein L27-A, 60S ribosomal protein L35-A, 60S ribosomal protein L29, 60S ribosomal protein L7-A, 60S ribosomal protein L30, 60S ribosomal protein L31-A, 60S ribosomal protein L32, 60S ribosomal protein L33-A, 60S ribosomal protein L34-A, 60S ribosomal protein L36-A, 60S ribosomal protein L37-A, 60S ribosomal protein L38, 60S ribosomal protein L39, 60S ribosomal protein L42-A, 60S ribosomal protein L43-A, Eukaryotic translation initiation factor 6, Large subunit GTPase 1, uL1, Probable metalloprotease ARX1, Tyrosine-protein phosphatase YVH1, Cytoplasmic 60S subunit biogenesis factor REI1, 60S ribosomal protein L24-A, 60S ribosomal export protein NMD3/RNA Complex Functional site 1) chain u residue 217 type sequence C description binding site for residue ZN u 401 source : AC7 2) chain u residue 220 type sequence C description binding site for residue ZN u 401 source : AC7 3) chain u residue 233 type sequence H description binding site for residue ZN u 401 source : AC7 4) chain u residue 239 type sequence H description binding site for residue ZN u 401 source : AC7 5) chain u residue 164 type sequence C description binding site for residue ZN u 402 source : AC8 6) chain u residue 167 type sequence C description binding site for residue ZN u 402 source : AC8 7) chain u residue 182 type sequence H description binding site for residue ZN u 402 source : AC8 8) chain u residue 187 type sequence H description binding site for residue ZN u 402 source : AC8 9) chain u residue 162-187 type ZN_FING sequence EQCLFCEHNKHFKDVEENLEHMFRTH description C2H2-type 2 source Swiss-Prot : SWS_FT_FI2 10) chain u residue 215-239 type ZN_FING sequence NICIVCNYQGRTLTAVRQHMLAKRH description C2H2-type 3 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links