eF-site ID 6rzz-l
PDB Code 6rzz
Chain l

click to enlarge
Title Cryo-EM structures of Lsg1-TAP pre-60S ribosomal particles
Classification RIBOSOME
Compound 25S ribosomal RNA
Source ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae; ORGANISM_COMMON: Baker's yeast;
Sequence l:  VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKR
RYDRKQSGFGGQTKPVFHKKAKTTKKVVLRLECVKCKTRA
QLTLKRCKHFELGG
Description (1)  60S ribosomal protein L2-A, 60S ribosomal protein L3, 60S ribosomal protein L4-A, 60S ribosomal protein L11-A, 60S ribosomal protein L9-A, 60S ribosomal protein L6-A, 60S ribosomal protein L8-A, 60S ribosomal protein L16-B, 60S ribosomal protein L13-A, 60S ribosomal protein L23-A, 60S ribosomal protein L14-A, 60S ribosomal protein L28, 60S ribosomal protein L15-A, 60S ribosomal protein L5, 60S ribosomal protein L18-A, 60S ribosomal protein L19-A, 60S ribosomal protein L20-A, 60S ribosomal protein L21-A, 60S ribosomal protein L17-A, 60S ribosomal protein L22-A, 60S ribosomal protein L25, 60S ribosomal protein L26-A, 60S ribosomal protein L27-A, 60S ribosomal protein L35-A, 60S ribosomal protein L29, 60S ribosomal protein L7-A, 60S ribosomal protein L30, 60S ribosomal protein L31-A, 60S ribosomal protein L32, 60S ribosomal protein L33-A, 60S ribosomal protein L34-A, 60S ribosomal protein L36-A, 60S ribosomal protein L37-A, 60S ribosomal protein L38, 60S ribosomal protein L39, 60S ribosomal protein L42-A, 60S ribosomal protein L43-A, Eukaryotic translation initiation factor 6, Large subunit GTPase 1, uL1, Probable metalloprotease ARX1, Tyrosine-protein phosphatase YVH1, Cytoplasmic 60S subunit biogenesis factor REI1, 60S ribosomal protein L24-A, 60S ribosomal export protein NMD3/RNA Complex


Functional site

1) chain l
residue 12
type
sequence C
description binding site for residue ZN l 201
source : AC3

2) chain l
residue 17
type
sequence C
description binding site for residue ZN l 201
source : AC3

3) chain l
residue 74
type
sequence C
description binding site for residue ZN l 201
source : AC3

4) chain l
residue 77
type
sequence C
description binding site for residue ZN l 201
source : AC3

5) chain l
residue 63-74
type prosite
sequence KTTKKVVLRLEC
description RIBOSOMAL_L44E Ribosomal protein L44e signature. KtTKKvvLRleC
source prosite : PS01172


Display surface

Download
Links