eF-site ID 6riq-M PDB Code 6riq Chain M click to enlarge Title MinCD filament from Pseudomonas aeruginosa Classification PROTEIN FIBRIL Compound MinC Source (A0A071KWM5_PSEAI) Sequence M:  AKILVVTSGKGGVGKTTTSAAIGTGLALRGFKTVIVDFDV GLRNLDLIMGCERRVVYDFVNVVNGEATLTQALIKDKRLE NLHVLAASQTRDKDALTKEGVEKVMAELRKDFEYIICDSP AGIEKGAHLAMYFADEAIVVTNPEVSSVRDSDRMLGLLAS KSQRAEKGEEPIKEHLLLTRYNPERVTKGEMLSVDDVEEI LAIRLLGVIPESQAVLKASNQGVPVILDEQSDAGQAYSDA VDRLLGKEIPHRFL Description (1)  MinC, Site-determining protein Functional site 1) chain M residue 17 type sequence T description binding site for residue MG M 301 source : AC6 2) chain M residue 119 type sequence D description binding site for residue MG M 301 source : AC6 3) chain M residue 11 type sequence K description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 4) chain M residue 12 type sequence G description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 5) chain M residue 13 type sequence G description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 6) chain M residue 14 type sequence V description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 7) chain M residue 15 type sequence G description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 8) chain M residue 17 type sequence T description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 9) chain M residue 18 type sequence T description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 10) chain M residue 19 type sequence T description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 11) chain M residue 20 type sequence S description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 12) chain M residue 45 type sequence N description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 13) chain M residue 119 type sequence D description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 14) chain M residue 120 type sequence S description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 15) chain M residue 180 type sequence T description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 16) chain M residue 181 type sequence R description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 17) chain M residue 210 type sequence I description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 18) chain M residue 211 type sequence P description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 19) chain M residue 212 type sequence E description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 20) chain M residue 213 type sequence S description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 21) chain M residue 216 type sequence V description binding site for Di-peptide ATP M 302 and LYS M 16 source : AD8 22) chain M residue 11 type sequence K description binding site for Di-peptide ATP N 302 and LYS N 16 source : AD9 23) chain M residue 12 type sequence G description binding site for Di-peptide ATP N 302 and LYS N 16 source : AD9 24) chain M residue 145 type sequence E description binding site for Di-peptide ATP N 302 and LYS N 16 source : AD9

Display surface Download Links