eF-site ID 6ri5-w PDB Code 6ri5 Chain w click to enlarge Title Cryo-EM structures of Lsg1-TAP pre-60S ribosomal particles Classification RIBOSOME Compound 25S RNA Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae; Sequence w:  TLLCCNCGTPIDGSTGLVMCYDCIKLTVDITQGIPREANI SFCRNCERFLQPPGQWIRAELESRELLAICLRRLKGLTKV RLVDASFIWTEPHSRRIRIKLTVQGEAMTNTIIQQTFEVE YIVIAMQCPDCARATVQIRQKVPHKRTFLFLEQLILKHNA HVDTISISEAKDGLDFFYAQKNHAVKMIDFLNAVVPIKHK KSEEKFSYSVEIVPICKDDLVVLPKKLAKSMGNISQFVLC SKISNTVQFMDPTTLQTADLSPSVYWRAPFNALADVTQLV EFIVLDVDSTGISRGNRVLADITVARTSDLGVNDQVYYVR SHLGGICHAGDSVMGYFIANSNYNSDLFDGLNIDYVPDVV LVKKLYQ Description Functional site 1) chain w residue 58 type sequence C description binding site for residue ZN w 601 source : AC5 2) chain w residue 61 type sequence C description binding site for residue ZN w 601 source : AC5 3) chain w residue 143 type sequence C description binding site for residue ZN w 601 source : AC5 4) chain w residue 146 type sequence C description binding site for residue ZN w 601 source : AC5 5) chain w residue 19 type sequence C description binding site for residue ZN w 602 source : AC6 6) chain w residue 22 type sequence C description binding site for residue ZN w 602 source : AC6 7) chain w residue 35 type sequence C description binding site for residue ZN w 602 source : AC6 8) chain w residue 38 type sequence C description binding site for residue ZN w 602 source : AC6

Display surface Download Links