eF-site ID 6ri5-i
PDB Code 6ri5
Chain i

click to enlarge
Title Cryo-EM structures of Lsg1-TAP pre-60S ribosomal particles
Classification RIBOSOME
Compound 25S RNA
Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae;
Sequence i:  GKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPA
AKTRSYNWGAKAKRRHTTGTGRMRYLKHVSRRFKNGFQTG
SASK
Description (1)  60S ribosomal protein L2-A, 60S ribosomal protein L3, 60S ribosomal protein L4-A, 60S ribosomal protein L11-A, 60S ribosomal protein L9-A, 60S ribosomal protein L6-A, 60S ribosomal protein L8-A, 60S ribosomal protein L16-B, 60S ribosomal protein L13-A, 60S ribosomal protein L23-A, 60S ribosomal protein L14-A, 60S ribosomal protein L28, 60S ribosomal protein L15-A, 60S ribosomal protein L5, 60S ribosomal protein L18-A, 60S ribosomal protein L19-A, 60S ribosomal protein L20-A, 60S ribosomal protein L21-A, 60S ribosomal protein L17-A, 60S ribosomal protein L22-A, 60S ribosomal protein L25, 60S ribosomal protein L26-A, 60S ribosomal protein L27-A, 60S ribosomal protein L35-A, 60S ribosomal protein L29, 60S ribosomal protein L7-A, 60S ribosomal protein L30, 60S ribosomal protein L31-A, 60S ribosomal protein L32, 60S ribosomal protein L33-A, 60S ribosomal protein L34-A, 60S ribosomal protein L36-A, 60S ribosomal protein L37-A, 60S ribosomal protein L38, 60S ribosomal protein L39, 60S ribosomal protein L42-A, 60S ribosomal protein L43-A, Eukaryotic translation initiation factor 6, Cytoplasmic 60S subunit biogenesis factor REH1, 60S ribosomal export protein NMD3, 60S ribosomal protein L24-A, Large subunit GTPase 1, 60S ribosomal protein L10, Ubiquitin-60S ribosomal protein L40/RNA Complex


Functional site

1) chain i
residue 19
type
sequence C
description binding site for residue ZN i 101
source : AC2

2) chain i
residue 22
type
sequence C
description binding site for residue ZN i 101
source : AC2

3) chain i
residue 34
type
sequence C
description binding site for residue ZN i 101
source : AC2

4) chain i
residue 37
type
sequence C
description binding site for residue ZN i 101
source : AC2

5) chain i
residue 4-23
type prosite
sequence GTPSFGKRHNKSHTLCNRCG
description RIBOSOMAL_L37E Ribosomal protein L37e signature. GTpSfGkRhnks.HtlCnRCG
source prosite : PS01077

6) chain i
residue 34
type CROSSLNK
sequence C
description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047
source Swiss-Prot : SWS_FT_FI2

7) chain i
residue 37
type CROSSLNK
sequence C
description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047
source Swiss-Prot : SWS_FT_FI2


Display surface

Download
Links