eF-site ID 6rfy-D PDB Code 6rfy Chain D click to enlarge Title Crystal structure of Eis2 form Mycobacterium abscessus Classification ANTIBIOTIC Compound Eis2 Source (A0A3A1BNP8_9MYCO) Sequence D:  ELTLRTIADEDDYESYMASAYSVFLRDPQKDEIEVNRKFT ELDRMIGFHDGKKWVATTGAFSRHVVLPGGAVVPVAAVTA VTVSPTHRRRGLLTTMMRHQLADIRSRGESLAMLFASEAL IYGRFGYGVATESAELSGQVRELAFRPTVDLGDGTLEEVS AETFLASAPAIYDAVIPGLPGQMSRTPEWWASWTLDSEEL QKESGKVRFVLHYESDGTASGFAIYRPKPGWAGPNAELHV QEVLGTNPRSYARTWRYLLDMDLVRKIKYHGASVQEELRY LVANHPSLECVVSDAIQVRLVDIPRALAQRRYAADVDVVL EVTDDFLPENSGRYRLRGGLDHASCEITTDDADIALTVRD LGSVYMGGVSLQVLASAGLVTELRAGAVQRAATAFGWPVA PSAPDDF Description (1)  Eis2 (E.C.2.3.1.-) Functional site 1) chain D residue 19 type sequence M description binding site for residue BTB D 501 source : AC6 2) chain D residue 22 type sequence A description binding site for residue BTB D 501 source : AC6 3) chain D residue 23 type sequence Y description binding site for residue BTB D 501 source : AC6 4) chain D residue 26 type sequence F description binding site for residue BTB D 501 source : AC6 5) chain D residue 28 type sequence R description binding site for residue BTB D 501 source : AC6 6) chain D residue 84 type sequence T description binding site for residue BTB D 501 source : AC6 7) chain D residue 120 type sequence E description binding site for residue BTB D 501 source : AC6 8) chain D residue 91 type sequence R description binding site for residue SO4 D 502 source : AC7 9) chain D residue 92 type sequence R description binding site for residue SO4 D 502 source : AC7 10) chain D residue 93 type sequence G description binding site for residue SO4 D 502 source : AC7 11) chain D residue 94 type sequence L description binding site for residue SO4 D 502 source : AC7 12) chain D residue 95 type sequence L description binding site for residue SO4 D 502 source : AC7 13) chain D residue 96 type sequence T description binding site for residue SO4 D 502 source : AC7 14) chain D residue 126 type sequence R description binding site for residue SO4 D 502 source : AC7

Display surface Download Links