eF-site ID 6rfy-B PDB Code 6rfy Chain B click to enlarge Title Crystal structure of Eis2 form Mycobacterium abscessus Classification ANTIBIOTIC Compound Eis2 Source (A0A3A1BNP8_9MYCO) Sequence B:  ELTLRTIADEDDYESYMASAYSVFLRDPQKDEIEVNRKFT ELDRMIGFHDGKKWVATTGAFSRHVVLPGGAVVPVAAVTA VTVSPTHRRRGLLTTMMRHQLADIRSRGESLAMLFASEAL IYGRFGYGVATESAELSGQVRELAFRPTVDLGDGTLEEVS AETFLASAPAIYDAVIPGLPGQMSRTPEWWASWTLDSEEL QKESGKVRFVLHYESDGTASGFAIYRPKPGWPNAELHVQE VLGTNPRSYARTWRYLLDMDLVRKIKYHGASVQEELRYLV ANHPSLECVVSDAIQVRLVDIPRALAQRRYAADVDVVLEV TDDFLPENSGRYRLRGGLDHASCEITTDDADIALTVRDLG SVYMGGVSLQVLASAGLVTELRAGAVQRAATAFGWPVAPS APDDF Description (1)  Eis2 (E.C.2.3.1.-) Functional site 1) chain B residue 19 type sequence M description binding site for residue BTB B 501 source : AC3 2) chain B residue 23 type sequence Y description binding site for residue BTB B 501 source : AC3 3) chain B residue 26 type sequence F description binding site for residue BTB B 501 source : AC3 4) chain B residue 28 type sequence R description binding site for residue BTB B 501 source : AC3 5) chain B residue 81 type sequence T description binding site for residue BTB B 501 source : AC3 6) chain B residue 82 type sequence A description binding site for residue BTB B 501 source : AC3 7) chain B residue 120 type sequence E description binding site for residue BTB B 501 source : AC3 8) chain B residue 91 type sequence R description binding site for residue SO4 B 502 source : AC4 9) chain B residue 92 type sequence R description binding site for residue SO4 B 502 source : AC4 10) chain B residue 93 type sequence G description binding site for residue SO4 B 502 source : AC4 11) chain B residue 94 type sequence L description binding site for residue SO4 B 502 source : AC4 12) chain B residue 95 type sequence L description binding site for residue SO4 B 502 source : AC4 13) chain B residue 96 type sequence T description binding site for residue SO4 B 502 source : AC4 14) chain B residue 126 type sequence R description binding site for residue SO4 B 502 source : AC4

Display surface Download Links