eF-site ID 6r8y-E PDB Code 6r8y Chain E click to enlarge Title Cryo-EM structure of NCP-6-4PP(-1)-UV-DDB Classification DNA BINDING PROTEIN Compound Histone H3.1 Source (DDB2_HUMAN) Sequence E:  VKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREI AQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHA KRVTIMPKDIQLARRIRGERA Description Functional site 1) chain E residue 57 type MOD_RES sequence K description N6-glutaryllysine; alternate => ECO:0000269|PubMed:31542297 source Swiss-Prot : SWS_FT_FI10 2) chain E residue 80 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435, ECO:0000269|PubMed:29211711 source Swiss-Prot : SWS_FT_FI21 3) chain E residue 81 type MOD_RES sequence T description Phosphothreonine => ECO:0000269|PubMed:20850016 source Swiss-Prot : SWS_FT_FI22 4) chain E residue 87 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI23 5) chain E residue 108 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI24 6) chain E residue 116 type MOD_RES sequence K description N6-glutaryllysine; alternate => ECO:0000269|PubMed:31542297 source Swiss-Prot : SWS_FT_FI25 7) chain E residue 123 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435, ECO:0000269|PubMed:27436229 source Swiss-Prot : SWS_FT_FI26

Display surface Download Links