eF-site ID 6r8y-F PDB Code 6r8y Chain F click to enlarge Title Cryo-EM structure of NCP-6-4PP(-1)-UV-DDB Classification DNA BINDING PROTEIN Compound Histone H3.1 Source (DDB2_HUMAN) Sequence F:  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKV FLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGF GG Description (1)  Histone H3.1, Histone H4, Histone H2A type 1-B/E, Histone H2B type 1-J, DNA damage-binding protein 1, DNA damage-binding protein 2/DNA Complex Functional site 1) chain F residue 60 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI16 2) chain F residue 80 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI16 3) chain F residue 32 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in UFM1); alternate => ECO:0000269|PubMed:30886146 source Swiss-Prot : SWS_FT_FI17 4) chain F residue 45 type MOD_RES sequence K description N6-propionyllysine; alternate => ECO:0000269|PubMed:17267393 source Swiss-Prot : SWS_FT_FI5 5) chain F residue 32 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI6 6) chain F residue 78 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI6 7) chain F residue 92 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI6 8) chain F residue 48 type MOD_RES sequence S description Phosphoserine; by PAK2 => ECO:0000269|PubMed:21724829, ECO:0007744|PubMed:17081983, ECO:0007744|PubMed:18669648, ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163, ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI8 9) chain F residue 52 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:15592455, ECO:0007744|PubMed:20068231 source Swiss-Prot : SWS_FT_FI9 10) chain F residue 60 type MOD_RES sequence K description N6-glutaryllysine; alternate => ECO:0000269|PubMed:31542297 source Swiss-Prot : SWS_FT_FI10 11) chain F residue 80 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P62806 source Swiss-Prot : SWS_FT_FI11 12) chain F residue 81 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:P62806 source Swiss-Prot : SWS_FT_FI12 13) chain F residue 89 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI13 14) chain F residue 92 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:19818714 source Swiss-Prot : SWS_FT_FI15

Display surface Download Links