eF-site ID 6r2w-L PDB Code 6r2w Chain L click to enlarge Title Crystal structure of the super-active FVIIa variant VYT in complex with tissue factor Classification HYDROLASE Compound Coagulation factor VII Source (TF_HUMAN) Sequence L:  ANAFLXXLRPGSLXRXCKXXQCSFXXARXIFKDAXRTKLF WISYSDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRN CETHKDDQLICVNENGGCEQYCSDHTGTKRSCRCHEGYSL LADGVSCTPTVEYPCGKIPILEK Description Functional site 1) chain L residue 61-72 type prosite sequence CKDQLQSYICFC description ASX_HYDROXYL Aspartic acid and asparagine hydroxylation site. CkDqlqsYiCfC source prosite : PS00010 2) chain L residue 16-41 type prosite sequence XCKXXQCSFXXARXIFKDAXRTKLFW description GLA_1 Vitamin K-dependent carboxylation domain. EckEEqCsfeearEifkdaertkl.FW source prosite : PS00011 3) chain L residue 70-81 type prosite sequence CFCLPAFEGRNC description EGF_1 EGF-like domain signature 1. CfClpAfeGRnC source prosite : PS00022 4) chain L residue 112-127 type prosite sequence CRCHEGYSLLADGVSC description EGF_2 EGF-like domain signature 2. CrCheGYslladgvsC source prosite : PS01186 5) chain L residue 46-70 type prosite sequence DGDQCASSPCQNGGSCKDQLQSYIC description EGF_CA Calcium-binding EGF-like domain signature. DgDQCassp..........Cqnggs..CkDqlqsYiC source prosite : PS01187 6) chain L residue 7 type BINDING sequence X description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 7) chain L residue 14 type BINDING sequence X description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 8) chain L residue 16 type BINDING sequence X description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 9) chain L residue 20 type BINDING sequence X description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 10) chain L residue 25 type BINDING sequence X description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 11) chain L residue 26 type BINDING sequence X description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 12) chain L residue 29 type BINDING sequence X description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 13) chain L residue 35 type BINDING sequence X description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 14) chain L residue 63 type MOD_RES sequence D description (3R)-3-hydroxyaspartate => ECO:0000269|PubMed:3264725 source Swiss-Prot : SWS_FT_FI4 15) chain L residue 60 type CARBOHYD sequence S description O-linked (Fuc) serine => ECO:0000269|PubMed:1904059, ECO:0000269|PubMed:9023546 source Swiss-Prot : SWS_FT_FI6 16) chain L residue 52 type CARBOHYD sequence S description O-linked (Xyl...) serine; alternate => ECO:0000269|PubMed:1904059, ECO:0000269|PubMed:2129367, ECO:0000269|PubMed:21949356, ECO:0000269|PubMed:2511201 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links