eF-site ID 6qxz_5-A PDB Code 6qxz Model 5 Chain A click to enlarge Title Solution structure of the ASHH2 CW domain with the N-terminal histone H3 tail mimicking peptide monomethylated on lysine 4 Classification TRANSFERASE Compound Histone-lysine N-methyltransferase ASHH2 Source (6QXZ) Sequence A:  GSRRASVGSEFTESAWVRCDDCFKWRRIPASVVGSIDESS RWICMNNSDKRFADCSKSQEMSNEEINEELGIGQDEADA Description Functional site 1) chain A residue 868 type sequence C description binding site for residue ZN A 1001 source : AC1 2) chain A residue 871 type sequence C description binding site for residue ZN A 1001 source : AC1 3) chain A residue 893 type sequence C description binding site for residue ZN A 1001 source : AC1 4) chain A residue 904 type sequence C description binding site for residue ZN A 1001 source : AC1 5) chain A residue 858 type sequence S description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3 source : AC2 6) chain A residue 859 type sequence E description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3 source : AC2 7) chain A residue 860 type sequence F description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3 source : AC2 8) chain A residue 861 type sequence T description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3 source : AC2 9) chain A residue 864 type sequence A description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3 source : AC2 10) chain A residue 865 type sequence W description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3 source : AC2 11) chain A residue 874 type sequence W description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3 source : AC2 12) chain A residue 915 type sequence I description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3 source : AC2 13) chain A residue 919 type sequence L description binding site for Ligand residues MLZ B 4 through GLN B 5 bound to THR B 3 source : AC2 14) chain A residue 903-915 type prosite sequence DCSKSQEMSNEEI description EF_HAND_1 EF-hand calcium-binding domain. DCSKSQEMSneEI source prosite : PS00018 15) chain A residue 871 type MOD_RES sequence C description Citrulline; alternate => ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 893 type MOD_RES sequence C description Citrulline; alternate => ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 904 type MOD_RES sequence C description Citrulline; alternate => ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links